GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 09:06:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_049920757             493 bp    mRNA    linear   INV 05-AUG-2022
DEFINITION  PREDICTED: Schistocerca cancellata nucleolar complex protein 2
            homolog (LOC126170885), mRNA.
ACCESSION   XM_049920757
VERSION     XM_049920757.1
DBLINK      BioProject: PRJNA856670
KEYWORDS    RefSeq.
SOURCE      Schistocerca cancellata (South American locust)
  ORGANISM  Schistocerca cancellata
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Polyneoptera; Orthoptera; Caelifera;
            Acrididea; Acridomorpha; Acridoidea; Acrididae;
            Cyrtacanthacridinae; Schistocerca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064626) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Schistocerca cancellata Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..493
                     /organism="Schistocerca cancellata"
                     /mol_type="mRNA"
                     /isolate="TAMUIC-IGC-003103"
                     /isolation_source="physical"
                     /specimen_voucher="TAMUIC-IGC-003103"
                     /db_xref="taxon:274614"
                     /chromosome="1"
                     /sex="female"
                     /tissue_type="Whole body"
                     /dev_stage="adult"
                     /country="Argentina"
                     /collection_date="2021-03-08"
                     /collected_by="Rick Overson"
                     /identified_by="Rick Overson"
     gene            1..493
                     /gene="LOC126170885"
                     /note="nucleolar complex protein 2 homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:126170885"
     CDS             63..368
                     /gene="LOC126170885"
                     /codon_start=1
                     /product="nucleolar complex protein 2 homolog"
                     /protein_id="XP_049776714.1"
                     /db_xref="GeneID:126170885"
                     /translation="
MSNCSVPTVTVKDKTGTVLVEIKGNKSQDLKEFSQTLKDVQKQVNTYLTNLIHNDAPGDSVNSDSDGSEDAEEEEDDDDDDNDQTAGSDDAGGPASKRKKC"
ORIGIN      
atttaccagagagtccacgttcgtatgaaacaccaaatcgtctaccatcaatctgccacataatgtcaaactgcagtgtaccaactgtaacagttaaagacaaaacaggaacggttctggtagaaataaaaggcaataaatcccaggatctcaaagaattttcacaaactttgaaggatgttcagaagcaagttaatacatacctcacaaacctcatccacaacgatgcaccaggagactctgtaaacagtgacagtgatggcagtgaagatgctgaagaagaagaagatgatgatgatgatgataatgatcagactgctggcagtgatgatgctggaggtccagcttctaaaagaaagaaatgctaattattatataataaaacgtgaaacttatgaaatgtgccgataacaaaagacacttttgtgtgatacttgctgtaaatatatctatattatcttcagagattaataattattgataaattaattac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]