GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 15:13:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_049277633             201 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Colletotrichum spaethianum uncharacterized protein (ColSpa_11421),
            partial mRNA.
ACCESSION   XM_049277633
VERSION     XM_049277633.1
DBLINK      BioProject: PRJNA858243
            BioSample: SAMD00334500
KEYWORDS    RefSeq.
SOURCE      Colletotrichum spaethianum
  ORGANISM  Colletotrichum spaethianum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae;
            Colletotrichum; Colletotrichum spaethianum species complex.
REFERENCE   1
  AUTHORS   Utami,Y.D. and Hiruma,K.
  TITLE     Genome data of Colletotrichum spp
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 201)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 201)
  AUTHORS   Utami,Y.D. and Hiruma,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAR-2022) Contact:Yuniar Devi Utami The University of
            Tokyo, Graduate School of Arts and Sciences; 3-8-1 Komaba,
            Meguro-ku, Tokyo 153-0041, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026054816).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..201
                     /organism="Colletotrichum spaethianum"
                     /mol_type="mRNA"
                     /strain="MAFF 239500"
                     /isolation_source="leaf"
                     /host="Rohdea japonica"
                     /db_xref="taxon:700344"
                     /chromosome="Unknown"
                     /country="Japan:Gunma"
                     /collection_date="2010-10"
     gene            <1..>201
                     /locus_tag="ColSpa_11421"
                     /old_locus_tag="ColLi_11421"
                     /db_xref="GeneID:73332223"
     CDS             1..201
                     /locus_tag="ColSpa_11421"
                     /old_locus_tag="ColLi_11421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_049133590.1"
                     /db_xref="GeneID:73332223"
                     /translation="
MAELLESVVNVAKKDEDKTLARDQAKENPSWPFDGHDEEPSEHPLLKADDTQQGGSGKSAPAEQNK"
ORIGIN      
atggccgagttacttgagagtgttgtcaacgtggcaaagaaggatgaggacaagaccttagcccgggatcaagctaaggaaaatcccagctggccttttgatggacacgatgaagagccctctgagcatcctcttctcaaggcggacgacacacaacagggcgggtctggcaagtcggctcctgcagaacaaaacaagtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]