2024-05-18 15:13:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_049277633 201 bp mRNA linear PLN 15-SEP-2023 DEFINITION Colletotrichum spaethianum uncharacterized protein (ColSpa_11421), partial mRNA. ACCESSION XM_049277633 VERSION XM_049277633.1 DBLINK BioProject: PRJNA858243 BioSample: SAMD00334500 KEYWORDS RefSeq. SOURCE Colletotrichum spaethianum ORGANISM Colletotrichum spaethianum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum spaethianum species complex. REFERENCE 1 AUTHORS Utami,Y.D. and Hiruma,K. TITLE Genome data of Colletotrichum spp JOURNAL Unpublished REFERENCE 2 (bases 1 to 201) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (13-SEP-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 201) AUTHORS Utami,Y.D. and Hiruma,K. TITLE Direct Submission JOURNAL Submitted (10-MAR-2022) Contact:Yuniar Devi Utami The University of Tokyo, Graduate School of Arts and Sciences; 3-8-1 Komaba, Meguro-ku, Tokyo 153-0041, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_026054816). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..201 /organism="Colletotrichum spaethianum" /mol_type="mRNA" /strain="MAFF 239500" /isolation_source="leaf" /host="Rohdea japonica" /db_xref="taxon:700344" /chromosome="Unknown" /country="Japan:Gunma" /collection_date="2010-10" gene <1..>201 /locus_tag="ColSpa_11421" /old_locus_tag="ColLi_11421" /db_xref="GeneID:73332223" CDS 1..201 /locus_tag="ColSpa_11421" /old_locus_tag="ColLi_11421" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_049133590.1" /db_xref="GeneID:73332223" /translation="
MAELLESVVNVAKKDEDKTLARDQAKENPSWPFDGHDEEPSEHPLLKADDTQQGGSGKSAPAEQNK"
ORIGIN
atggccgagttacttgagagtgttgtcaacgtggcaaagaaggatgaggacaagaccttagcccgggatcaagctaaggaaaatcccagctggccttttgatggacacgatgaagagccctctgagcatcctcttctcaaggcggacgacacacaacagggcgggtctggcaagtcggctcctgcagaacaaaacaagtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]