2024-05-19 07:02:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_047944513 315 bp mRNA linear PLN 29-DEC-2023 DEFINITION Puccinia striiformis f. sp. tritici uncharacterized protein (Pst134EA_009155), partial mRNA. ACCESSION XM_047944513 VERSION XM_047944513.1 DBLINK BioProject: PRJNA835130 BioSample: SAMN20585433 KEYWORDS RefSeq. SOURCE Puccinia striiformis f. sp. tritici ORGANISM Puccinia striiformis f. sp. tritici Eukaryota; Fungi; Dikarya; Basidiomycota; Pucciniomycotina; Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia. REFERENCE 1 (bases 1 to 315) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 2 (bases 1 to 315) AUTHORS Schwessinger,B. TITLE Direct Submission JOURNAL Submitted (25-AUG-2021) Research School Biology, Australian National University, Linnaeus Way, Acton 2000, Australia COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_063030). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..315 /organism="Puccinia striiformis f. sp. tritici" /mol_type="mRNA" /strain="134E16A+17+33+" /isolation_source="plant" /host="wheat" /db_xref="taxon:168172" /chromosome="5" /country="Australia: Wagga Wagga" /lat_lon="35.1082 S 147.3598 E" /collection_date="2017-08" /forma_specialis="tritici" gene <1..>315 /locus_tag="Pst134EA_009155" /db_xref="GeneID:72025441" CDS 1..315 /locus_tag="Pst134EA_009155" /codon_start=1 /product="hypothetical protein" /protein_id="XP_047808074.1" /db_xref="GeneID:72025441" /translation="
MVGLSLQYPGFHQQAISHLHRLLLCTPPPPPKTSSLANARLTTPPAQKKSTSSLTLHAFISSFHFSIVPVTKFSEHPLCRHVFYFSLPSVVSLTEMYNELVVRI"
ORIGIN
atggtgggactgtccttacaatatcccggattccaccaacaagcaatatctcacctgcaccgactgctactatgtaccccccctcccccccccaaaacatcatccttagcaaacgcaaggctcaccactccccccgctcaaaaaaaatccacatcatcattgactctccacgctttcatctcctcatttcatttttccattgtgccagtcaccaagttcagcgaacatcccttatgcaggcatgtcttttatttttctctaccaagtgtggtttccttgacggaaatgtacaatgagcttgtagttagaatttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]