2024-05-20 02:37:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_046333154 568 bp mRNA linear VRT 05-MAR-2022 DEFINITION PREDICTED: Oncorhynchus gorbuscha uncharacterized LOC124017895 (LOC124017895), transcript variant X2, mRNA. ACCESSION XM_046333154 VERSION XM_046333154.1 DBLINK BioProject: PRJNA726253 KEYWORDS RefSeq. SOURCE Oncorhynchus gorbuscha (pink salmon) ORGANISM Oncorhynchus gorbuscha Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025745205) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Oncorhynchus gorbuscha Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..568 /organism="Oncorhynchus gorbuscha" /mol_type="mRNA" /isolate="QuinsamMale2020" /db_xref="taxon:8017" /chromosome="Unknown" /sex="male" /tissue_type="Multiple" /dev_stage="Spawning" /ecotype="Even-year" /collection_date="2020-07-28" /collected_by="Quinsam River Hatchery" gene 1..568 /gene="LOC124017895" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:124017895" CDS 101..520 /gene="LOC124017895" /codon_start=1 /product="uncharacterized protein LOC124017895 isoform X2" /protein_id="XP_046189110.1" /db_xref="GeneID:124017895" /translation="
METLTATAVQDICQFMEETYAALRVEMLQEQNRSSRTKFQAMENSKGKEKPANSMESVQEDGFRNFPVVEQILNEQEANGLWLEGHLTVEDAGPLSLAPEEEQPLQSFGQMTDKGVETCSAPLVIKQEETDDVMESQVP"
ORIGIN
gtatccttccactgtcaggtgttgaaccacacgcatcaacttttgtatttgtgtaactatttctttcggacatgcctttcgttctcgtgttgccttcattatggaaaccttgacagcaacagccgtgcaagacatttgtcaatttatggaagaaacgtatgctgctcttcgagtggaaatgttgcaagaacaaaaccgaagttcgaggacaaaatttcaggcgatggagaatagcaaggggaaagaaaagcctgcgaacagtatggagagcgttcaagaagacggtttcagaaacttcccagtcgtggagcaaatcctcaatgaacaagaggccaatggtctttggctagaaggtcaccttactgtggaagatgcaggtccactgtcactggcaccagaggaagaacagccattgcagagttttggtcagatgacagacaagggagtggagacatgttcagcaccgctggtcattaaacaggaggaaacggatgatgtcatggagtctcaagtaccataaaggcctgattggtggagtgctgcagagatggttgtccttctggaaggt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]