2024-05-17 08:42:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_045944438 308 bp mRNA linear PLN 15-JAN-2022 DEFINITION PREDICTED: Trifolium pratense protein CLAVATA 3 (LOC123894433), mRNA. ACCESSION XM_045944438 VERSION XM_045944438.1 DBLINK BioProject: PRJNA796348 KEYWORDS RefSeq. SOURCE Trifolium pratense ORGANISM Trifolium pratense Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Trifolieae; Trifolium. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060065) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Trifolium pratense Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..308 /organism="Trifolium pratense" /mol_type="mRNA" /cultivar="HEN17-A07" /db_xref="taxon:57577" /tissue_type="leaves" /dev_stage="Mature plant" /country="USA: Madison, WI" /linkage_group="LG7" gene 1..308 /gene="LOC123894433" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 73% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:123894433" CDS 9..308 /gene="LOC123894433" /codon_start=1 /product="protein CLAVATA 3" /protein_id="XP_045800394.1" /db_xref="GeneID:123894433" /translation="
MASKFIFSSFFILVLFCLLLMRETSGCNSTYACSYANGGSLRMIQNRKMLSGLKVSLEGSSTKMKYGEKAVIGELRKVPSGPDPLHHHNIGNPIKPETP"
ORIGIN
taaaaattatggcttcaaaattcatcttttcttctttctttatacttgttctgttttgcttgcttcttatgagggagacttctggttgcaattctacatatgcatgctcctatgctaatggaggaagtcttagaatgattcaaaataggaagatgctgtctggtttgaaggttagtctagaaggatcttcaacaaagatgaagtatggtgaaaaggcagtgattggagagttgaggaaggttcctagtggtccagatccattgcatcatcataacattggcaaccctattaagcctgaaactccttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]