GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 08:42:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_045944438             308 bp    mRNA    linear   PLN 15-JAN-2022
DEFINITION  PREDICTED: Trifolium pratense protein CLAVATA 3 (LOC123894433),
            mRNA.
ACCESSION   XM_045944438
VERSION     XM_045944438.1
DBLINK      BioProject: PRJNA796348
KEYWORDS    RefSeq.
SOURCE      Trifolium pratense
  ORGANISM  Trifolium pratense
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; Hologalegina; IRL clade;
            Trifolieae; Trifolium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060065) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Trifolium pratense Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..308
                     /organism="Trifolium pratense"
                     /mol_type="mRNA"
                     /cultivar="HEN17-A07"
                     /db_xref="taxon:57577"
                     /tissue_type="leaves"
                     /dev_stage="Mature plant"
                     /country="USA: Madison, WI"
                     /linkage_group="LG7"
     gene            1..308
                     /gene="LOC123894433"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 73% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:123894433"
     CDS             9..308
                     /gene="LOC123894433"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_045800394.1"
                     /db_xref="GeneID:123894433"
                     /translation="
MASKFIFSSFFILVLFCLLLMRETSGCNSTYACSYANGGSLRMIQNRKMLSGLKVSLEGSSTKMKYGEKAVIGELRKVPSGPDPLHHHNIGNPIKPETP"
ORIGIN      
taaaaattatggcttcaaaattcatcttttcttctttctttatacttgttctgttttgcttgcttcttatgagggagacttctggttgcaattctacatatgcatgctcctatgctaatggaggaagtcttagaatgattcaaaataggaagatgctgtctggtttgaaggttagtctagaaggatcttcaacaaagatgaagtatggtgaaaaggcagtgattggagagttgaggaaggttcctagtggtccagatccattgcatcatcataacattggcaaccctattaagcctgaaactccttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]