2024-05-17 02:02:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_045122971 768 bp mRNA linear PLN 12-NOV-2021 DEFINITION PREDICTED: Hordeum vulgare subsp. vulgare protein FLORAL ORGAN NUMBER2 (LOC123446299), mRNA. ACCESSION XM_045122971 VERSION XM_045122971.1 DBLINK BioProject: PRJNA774802 KEYWORDS RefSeq. SOURCE Hordeum vulgare subsp. vulgare (domesticated barley) ORGANISM Hordeum vulgare subsp. vulgare Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_058521.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Hordeum vulgare subsp. vulgare Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..768 /organism="Hordeum vulgare subsp. vulgare" /mol_type="mRNA" /sub_species="vulgare" /db_xref="taxon:112509" /chromosome="4H" gene 1..768 /gene="LOC123446299" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 59 samples with support for all annotated introns" /db_xref="GeneID:123446299" CDS 73..444 /gene="LOC123446299" /codon_start=1 /product="protein FLORAL ORGAN NUMBER2" /protein_id="XP_044978906.1" /db_xref="GeneID:123446299" /translation="
MRNSSLMVRLKVALPSMATVRFLLCLLVAWCCAALVILVPPAHARVGLVGGFGGRDNPAAAGFLHVGSESKQQQQPRGGGGSRYAWWSPPAWNEELRSVPAGPDPLHHHGSPRRPEQEPEHLP"
polyA_site 768 /gene="LOC123446299" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tctcctaccagtacagtatatagtgcaagatggttttatctataagaagccctgtatgtccctttgggagacatgcgcaactcaagtttgatggtgcgactgaaggttgctttgccatccatggccacggtccggttcttgctgtgcttgctggttgcatggtgttgcgcggctctcgtcatccttgtccctccagcgcacgcacgtgttgggctggtgggtgggttcggcggtcgcgataacccggctgccgcgggatttctccatgtgggatcggagtccaagcagcagcagcagccgcgcggcggcggcggcagcaggtatgcgtggtggtcgccaccggcatggaacgaggagctgcggtcggtaccggctgggccggacccgctgcaccaccacggcagcccgaggcggccggagcaggagccagagcacctcccgtgaggacaaataagcaatccgcgggcacgccattggcccctttctgggatgtgatgtacaaacacgcgtgtttcatgctttgccgtgatgtaccaacaatgcgttcgtttggtgttttgaacaagagtagtccatgccctccctccgattttcattactagctataccagtctcgttgtttcactgtacgttagcatttgtgatcgatgcggtgcgtcatcgactcgtcggcccgtggaactggatatatccgtgccctcatagtgaagtccttagagcaactctagcagacagtttatatcaaacacctgtatggtcttttacgta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]