2024-05-20 06:07:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_044648277 761 bp mRNA linear PLN 19-OCT-2021 DEFINITION PREDICTED: Mangifera indica LOB domain-containing protein 1-like (LOC123224552), mRNA. ACCESSION XM_044648277 VERSION XM_044648277.1 DBLINK BioProject: PRJNA771370 KEYWORDS RefSeq. SOURCE Mangifera indica (mango) ORGANISM Mangifera indica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae; Mangifera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_058144.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Mangifera indica Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..761 /organism="Mangifera indica" /mol_type="mRNA" /cultivar="Alphonso" /db_xref="taxon:29780" /chromosome="8" /tissue_type="mature leaf" /country="China: Danzhou, Hainan" gene 1..761 /gene="LOC123224552" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 19 samples with support for all annotated introns" /db_xref="GeneID:123224552" CDS 1..519 /gene="LOC123224552" /codon_start=1 /product="LOB domain-containing protein 1-like" /protein_id="XP_044504212.1" /db_xref="GeneID:123224552" /translation="
MDSEKVLRIRTHQPCAACKMLRRRCDNNCTLAPYFPTDEIEKFACVHKVFGASNVIKMIQMVEEIKREDAVKALVYEAKARLRDPVYGSAGATSHLYKMVQDLKVELESMQTQIVALQEQRNQLLSILMNVHHQDPVYSINDSTIDCGNFSVDDGSLAYDPVNFPVACDRIL"
misc_feature 40..333 /gene="LOC123224552" /note="Lateral organ boundaries (LOB) domain; Region: LOB; pfam03195" /db_xref="CDD:427193" polyA_site 761 /gene="LOC123224552" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
atggattctgaaaaggtgttaagaatcaggactcatcaaccttgtgccgcatgtaagatgctacgtcggagatgtgacaacaattgcactcttgcaccatattttccaaccgatgagatagaaaagtttgcctgtgtgcacaaagtttttggcgctagcaatgtcattaaaatgattcagatggttgaggagataaagagagaagatgccgtcaaagcactagtttacgaagcaaaagcaaggcttagagaccctgtttatggcagtgccggggctacctctcacttgtataagatggttcaggatctgaaagttgagttggaatcaatgcaaactcaaattgtggcgttgcaagaacaaagaaatcagttattaagtattcttatgaatgttcatcaccaggatcctgtctactccataaatgactccacaattgactgtggcaatttctcagtagatgatggatctctggcctatgatcctgtcaactttcctgtggcatgtgacaggattttgtaaggggattctaattctctccagtattttatgaggtgaattaccagagttgttgctttaaaaaggtagagatgatttagtaagaaagtacccatggaagtatactggtttaatttgaagaaatgttctacagtagaatcaaaatttggactttgtaatgtgttcttgtatagctattaactattgactccttttatcagtttaccacagttacagatttcttataattaagatgacttttttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]