GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 06:07:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_044648277             761 bp    mRNA    linear   PLN 19-OCT-2021
DEFINITION  PREDICTED: Mangifera indica LOB domain-containing protein 1-like
            (LOC123224552), mRNA.
ACCESSION   XM_044648277
VERSION     XM_044648277.1
DBLINK      BioProject: PRJNA771370
KEYWORDS    RefSeq.
SOURCE      Mangifera indica (mango)
  ORGANISM  Mangifera indica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae;
            Mangifera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_058144.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Mangifera indica Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..761
                     /organism="Mangifera indica"
                     /mol_type="mRNA"
                     /cultivar="Alphonso"
                     /db_xref="taxon:29780"
                     /chromosome="8"
                     /tissue_type="mature leaf"
                     /country="China: Danzhou, Hainan"
     gene            1..761
                     /gene="LOC123224552"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 19 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:123224552"
     CDS             1..519
                     /gene="LOC123224552"
                     /codon_start=1
                     /product="LOB domain-containing protein 1-like"
                     /protein_id="XP_044504212.1"
                     /db_xref="GeneID:123224552"
                     /translation="
MDSEKVLRIRTHQPCAACKMLRRRCDNNCTLAPYFPTDEIEKFACVHKVFGASNVIKMIQMVEEIKREDAVKALVYEAKARLRDPVYGSAGATSHLYKMVQDLKVELESMQTQIVALQEQRNQLLSILMNVHHQDPVYSINDSTIDCGNFSVDDGSLAYDPVNFPVACDRIL"
     misc_feature    40..333
                     /gene="LOC123224552"
                     /note="Lateral organ boundaries (LOB) domain; Region: LOB;
                     pfam03195"
                     /db_xref="CDD:427193"
     polyA_site      761
                     /gene="LOC123224552"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
atggattctgaaaaggtgttaagaatcaggactcatcaaccttgtgccgcatgtaagatgctacgtcggagatgtgacaacaattgcactcttgcaccatattttccaaccgatgagatagaaaagtttgcctgtgtgcacaaagtttttggcgctagcaatgtcattaaaatgattcagatggttgaggagataaagagagaagatgccgtcaaagcactagtttacgaagcaaaagcaaggcttagagaccctgtttatggcagtgccggggctacctctcacttgtataagatggttcaggatctgaaagttgagttggaatcaatgcaaactcaaattgtggcgttgcaagaacaaagaaatcagttattaagtattcttatgaatgttcatcaccaggatcctgtctactccataaatgactccacaattgactgtggcaatttctcagtagatgatggatctctggcctatgatcctgtcaactttcctgtggcatgtgacaggattttgtaaggggattctaattctctccagtattttatgaggtgaattaccagagttgttgctttaaaaaggtagagatgatttagtaagaaagtacccatggaagtatactggtttaatttgaagaaatgttctacagtagaatcaaaatttggactttgtaatgtgttcttgtatagctattaactattgactccttttatcagtttaccacagttacagatttcttataattaagatgacttttttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]