LOCUS       XM_044259767            1052 bp    mRNA    linear   MAM 13-OCT-2021
DEFINITION  PREDICTED: Neovison vison copper chaperone for superoxide dismutase
            (CCS), transcript variant X4, mRNA.
ACCESSION   XM_044259767
VERSION     XM_044259767.1
DBLINK      BioProject: PRJNA769404
KEYWORDS    RefSeq.
SOURCE      Neogale vison (American mink)
  ORGANISM  Neogale vison
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Musteloidea; Mustelidae; Mustelinae; Neogale.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_058097.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Neovison vison Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1052
                     /organism="Neogale vison"
                     /mol_type="mRNA"
                     /isolate="M4711"
                     /db_xref="taxon:452646"
                     /chromosome="7"
                     /sex="female"
                     /tissue_type="tongue"
                     /dev_stage="mature"
     gene            1..1052
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 3 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:122913160"
     CDS             84..752
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X4"
                     /protein_id="XP_044115702.1"
                     /db_xref="GeneID:122913160"
                     /translation="

MASDSGDGGTACTLEFTVQMTCQSCVDAVRTSLQGVAGKSQNNLRTVRRPLGGAGKPLKPTTLFPFTHVEEHRGRRKERLPSRTETRSQSLEYRSQACQARALYRLWCVLYLRCLGSEELDWAYMGPPPEGVSWIASSCCLRNGIILTKPTAALAMFHPRQLPILMSQLTGLEATLHGQKHLRRQSHQPGPGNRLPLILLNVHPVIQQGTMSMQASLMEEMR"

     misc_feature    123..>197
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      

ctccacctccccgctacgccgttaaggttttgcacttgagccgcggaatagttgaggcctttccgccggtggctgggtccgggatggcttcggactccggggacggcgggaccgcctgcacgttggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggggtggcaggtaagagccagaacaacttgcggacagttcggaggcctctaggaggagccggcaaacctcttaaaccaacaacactattcccatttacacatgtggaagaacacagaggtaggaggaaggaacgtcttccgagtcgcacggagacccggagtcagagccttgagtacagatctcaagcctgccaggccagagccctctacaggctctggtgcgtcttatatctcaggtgcctagggagtgaggagctagactgggcatacatgggcccacctccagagggtgtttcctggatagcaagcagctgttgcttgcgaaatggcataatcttgacaaagccaacagcagccctggccatgttccatcctaggcagctcccaattcttatgagccagctaactggtctggaggcgaccttgcacggtcagaaacatctgagaaggcagagccaccagcctggccctgggaaccgcttgcctttgattctgttaaatgttcatccagtcattcagcagggaacgatgagcatgcaagcgtcgctcatggaagagatgaggtgagatggattctaagctgggacagtggtggcacttggccggtacagggcagcgataagggtatgtgacttcaaatccctttctttgcattcacatcccagctttgcctcttagcctcacgtagacgtcatgcatgttactacttttgcctgtttcttctgtgtttaaatggggatgaaaatggaagctaccttggaggattgtcgtgaagagttagttggttaatacctgtaaagcactttattttttgtttaaagattttatttatttgacagacagagatcacaggtaggcagaaaggca

//