LOCUS       XM_043990225             734 bp    mRNA    linear   MAM 28-SEP-2021
DEFINITION  PREDICTED: Dromiciops gliroides zinc finger protein 215-like
            (LOC122744641), transcript variant X9, mRNA.
ACCESSION   XM_043990225
VERSION     XM_043990225.1
DBLINK      BioProject: PRJNA764759
KEYWORDS    RefSeq.
SOURCE      Dromiciops gliroides (monito del monte)
  ORGANISM  Dromiciops gliroides
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Metatheria; Microbiotheria; Microbiotheriidae;
            Dromiciops.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_057862.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Dromiciops gliroides Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..734
                     /organism="Dromiciops gliroides"
                     /mol_type="mRNA"
                     /isolate="mDroGli1"
                     /db_xref="taxon:33562"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="kidney, liver"
                     /dev_stage="adult"
                     /country="Chile: San Martin, comuna de Valdivia, Region de
                     los Rios"
                     /lat_lon="39.647794 S 73.196942 W"
                     /collection_date="2014-02-10"
                     /collected_by="Roberto Nespolo, Julian Quintero"
     gene            1..734
                     /gene="LOC122744641"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 3 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:122744641"
     CDS             274..594
                     /gene="LOC122744641"
                     /codon_start=1
                     /product="zinc finger protein 215-like isoform X1"
                     /protein_id="XP_043846160.1"
                     /db_xref="GeneID:122744641"
                     /translation="

MKSEHPLNSKEGMTMEELMNMFEKKALPEKYDFLPKQSTEVEEMTSGLLASRSQESLMFKEYAYELQPKMEWGHLDSAQKGLYRDVMLENYSTWLHWQDIRVPSQM"

     misc_feature    442..>552
                     /gene="LOC122744641"
                     /note="krueppel associated box; Region: KRAB; smart00349"
                     /db_xref="CDD:214630"
ORIGIN      

aggtaggtgtgatcctgtcattgtccttgggtctgtgtatgaaaagaagaaaggaccctgaatccatgggtctgtgtgtctgtccatgtgtctgtatgtgaagagagggcagaggaccacatgcgtgcacgtgtttgtgattccttctccaaaagaacgtgaagatagaagaggccactcctgaagaacaggatctttctttagaacctttgtgtggagttagagattgctggaacaattcctgaccatcttgccctaggagacattacttggatgaaatcggagcatccactgaacagcaaagaaggaatgactatggaagagctgatgaacatgtttgagaagaaagctctgcctgagaagtatgactttctccccaaacagagcacagaggtggaggaaatgacctctgggctcctggcatccagatcccaggaatcgctgatgttcaaggaatatgcctatgagcttcaacccaagatggaatggggacatttggattctgctcagaaaggtctttatagagatgtgatgctggagaactatagtacctggcttcattggcaggacatccgggttccaagccagatgtgatttctcagttggagcatggaaaaggcccatggaacaagaagaaaattccaaaaagcaaccgcctaggaatgactcaaatgcctctcttttgttgaagttccatgtgtatccattgataatattaggctattttaacttag

//