LOCUS       XM_043766215             318 bp    mRNA    linear   PLN 21-SEP-2021
DEFINITION  PREDICTED: Erigeron canadensis protein CLAVATA 3 (LOC122593738),
            mRNA.
ACCESSION   XM_043766215
VERSION     XM_043766215.1
DBLINK      BioProject: PRJNA763527
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Erigeron canadensis
  ORGANISM  Erigeron canadensis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Astereae; North American clade; Conyzinae; Erigeron.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_057761.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Erigeron canadensis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 14% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..318
                     /organism="Erigeron canadensis"
                     /mol_type="mRNA"
                     /isolate="Cc75"
                     /db_xref="taxon:72917"
                     /chromosome="1"
                     /tissue_type="leaves"
                     /country="Canada"
     gene            1..318
                     /gene="LOC122593738"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 32% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:122593738"
     CDS             1..318
                     /gene="LOC122593738"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_043622150.1"
                     /db_xref="GeneID:122593738"
                     /translation="

MAFAFKSLSFSFILLLCVLFLLQISWGIYGAEKTISCDPSMKVMGNRKLLVVNGLEAKQEVLKIDGKKSTRKEDQYYVGWELRAAPLGPDPLHHHGADPKKPRTP"

ORIGIN      

atggcttttgcattcaaatcactttctttctctttcattttgttactttgcgtgctttttctcttacaaatctcttggggtatctatggtgcagaaaagaccatctcatgtgacccttctatgaaagttatgggtaacaggaagttgttggtggtgaatggtttggaagcaaagcaagaagttttgaagatagatgggaagaagagtactaggaaagaggaccaatattatgtgggttgggaactaagggcagcaccattgggcccagacccacttcaccatcatggtgctgacccaaagaagccaagaactccttga

//