LOCUS       XM_043444098             836 bp    mRNA    linear   MAM 06-SEP-2021
DEFINITION  PREDICTED: Cervus canadensis ankyrin repeat and LEM
            domain-containing protein 2-like (LOC122425601), transcript variant
            X3, mRNA.
ACCESSION   XM_043444098
VERSION     XM_043444098.1
DBLINK      BioProject: PRJNA758978
KEYWORDS    RefSeq.
SOURCE      Cervus canadensis
  ORGANISM  Cervus canadensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Cervidae; Cervinae; Cervus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_057408.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cervus canadensis Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Cervus canadensis"
                     /mol_type="mRNA"
                     /isolate="Bull #8, Minnesota"
                     /db_xref="taxon:1574408"
                     /chromosome="23"
                     /sex="male"
                     /tissue_type="white blood cells"
     gene            1..836
                     /gene="LOC122425601"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 2 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:122425601"
     CDS             14..262
                     /gene="LOC122425601"
                     /codon_start=1
                     /product="ankyrin repeat and LEM domain-containing protein
                     2-like isoform X3"
                     /protein_id="XP_043300033.1"
                     /db_xref="GeneID:122425601"
                     /translation="

MLWPRLAATEWAALAWELLGASVLLIAVRWLVRRLDRRPRGLGQSGPPDPPPRAAAGPAPDPAQMCLKDKTGTFMLWNAAQQ"

ORIGIN      

gtgagttgtggcgatgctgtggccgcggctggcggcgactgagtgggcggcgttggcctgggagctgctgggcgcctcggtgctgctgatcgcggtgcgctggctggtgcggcggttggacaggcggccgcggggcctgggtcagagcggtccacccgacccgccgccccgcgcggccgcgggcccagcccccgatccagcccagatgtgtctgaaggataaaactggcaccttcatgctgtggaatgctgctcagcagtgaggccaaactgttgatccctcagcaacgtggatggatctcaaaggcattacgctgagtgaaaaaagccaacctcaaaaggtctgtagtgtataattccatttatataacatgaagtaaaggtattataacaatgggggacacctcagtggttttcatgggtaggggacagtggaggaagttggatgtgacagtcaagggttggcagaaagatctttgtggtgacggaacagttcagtaatttagcatgtctgtgtgaagctattcgtgtgataaacgatcatatggtaagggatcacggagttacatacaaagacacaagaggagagtgactgcagaacctggtgaggttgcggttagtgccagggtcggctgcctgggttggatgcagtgtttcaggtgtcccactgagagaagccacatagtgactccacaagacttctctgtaccatttttcaactccttgtgtttatcattaaaatataaaataaagagttaaagaaaccctgtatacatccacttagattcccaaatgttaggatcttgtgtaatcatactgctagtaataaggtcagga

//