2024-05-19 03:30:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_042483197 448 bp mRNA linear VRT 19-JUL-2021 DEFINITION PREDICTED: Plectropomus leopardus potassium-transporting ATPase alpha chain 1-like (LOC121940419), partial mRNA. ACCESSION XM_042483197 VERSION XM_042483197.1 DBLINK BioProject: PRJNA744194 KEYWORDS RefSeq. SOURCE Plectropomus leopardus (leopard coralgrouper) ORGANISM Plectropomus leopardus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Perciformes; Serranoidei; Serranidae; Epinephelinae; Epinephelini; Plectropomus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024695405.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Plectropomus leopardus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..448 /organism="Plectropomus leopardus" /mol_type="mRNA" /isolate="mb" /db_xref="taxon:160734" /chromosome="Unknown" /tissue_type="muscle" gene <1..>448 /gene="LOC121940419" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:121940419" CDS <1..>448 /gene="LOC121940419" /codon_start=1 /product="potassium-transporting ATPase alpha chain 1-like" /protein_id="XP_042339131.1" /db_xref="GeneID:121940419" /translation="
GSIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELATDIFPSVSLAYEKAESDIMHLKPRNPRRDRLVNEALAVYSYFQI"
misc_feature <1..447 /gene="LOC121940419" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
ggctctatcgttgctgtgacaggtgatggtgtgaacgactctccggctctcaagaaggctgatatcggtgtcgccatggggatcgccgggtcagatgctgccaagaacgccgcagacatgatcctgttggacgacaactttgcttctatcgtcaccggagtggagcagggccgtcttatctttgacaacctgaagaagtctatcgcctacacactgaccaagaacatccctgagctgactccatatctgatctacatcaccgtcagcgtgcctcttcctctgggctgcatcacgattctcttcatcgaactggccactgacatttttccctccgtctctctggcttatgagaaagcagagagtgacatcatgcacctgaagcccaggaaccctcgacgtgatcgccttgtaaacgaagccctggctgtgtactcgtacttccagatcg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]