GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 05:17:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_041402309            1452 bp    mRNA    linear   VRT 05-MAY-2021
DEFINITION  PREDICTED: Onychostruthus taczanowskii homeobox B8 (HOXB8),
            transcript variant X1, mRNA.
ACCESSION   XM_041402309
VERSION     XM_041402309.1
DBLINK      BioProject: PRJNA703052
KEYWORDS    RefSeq.
SOURCE      Onychostruthus taczanowskii (white-rumped snowfinch)
  ORGANISM  Onychostruthus taczanowskii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea;
            Passeridae; Onychostruthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024499206.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Onychostruthus taczanowskii
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1452
                     /organism="Onychostruthus taczanowskii"
                     /mol_type="mRNA"
                     /isolate="IOZ18803"
                     /db_xref="taxon:356909"
                     /chromosome="Unknown"
                     /sex="pooled male and female"
                     /tissue_type="blood"
                     /altitude="4200 m"
     gene            1..1452
                     /gene="HOXB8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 26 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 5 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:121334817"
     CDS             36..764
                     /gene="HOXB8"
                     /codon_start=1
                     /product="homeobox protein Hox-B8 isoform X1"
                     /protein_id="XP_041258243.1"
                     /db_xref="GeneID:121334817"
                     /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGASAGGTFQPPPQIQEFYHGASSLSSSPYQQNPCAVACHGEPGSFYGYEPLQRQSVFGPQEPELLQYADCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEADEEGEAQKADKK"
     misc_feature    order(471..485,489..491,540..542,558..560,597..599,
                     603..608,615..620,624..632,636..641)
                     /gene="HOXB8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(477..479,486..488,606..608,615..620,627..629)
                     /gene="HOXB8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    480..638
                     /gene="HOXB8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
ORIGIN      
aaaaaaaagaacaacaacctcttattgaaattaaaatgagctcctattttgtcaactcactcttctccaaatacaaaaccggcgactccctgcgccccaattactacgactgcggcttcgcccaggatctggggggcagacccaccgtggtgtacggagccagcgccgggggcaccttccagccccctccccaaatccaggagttctaccacggcgcctcgtcgctctccagctccccttaccagcagaacccgtgcgccgtggcttgccatggggagccgggcagcttctacggctacgagcccctgcagcggcagagcgtgttcgggccgcaggagcccgagctgctgcagtacgcggactgcaagctggcggccagcggcctcggcgaggaggcggagagctccgagcagagcccttctcccacccagcttttcccctggatgcgaccgcaagcagccgccggacgcaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaagcggaggatcgaggtctcgcacgccctgggcttgacagagaggcaggtcaaaatctggttccagaacaggaggatgaagtggaaaaaggagaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggcggacgaggaaggggaagcacagaaggcggacaagaaataaagggatttttttttttttgaggactgaaaggcaagcgctgctggggtggaagagccccccgagccccgcgttaatggcagtcggtgtaagggaggggtgggctgggggggacacacaaaaaaaaaaaacaacaaaccagaaaaacaaagcctagaaaatacaaaaaaaaaaaaagaaaaaccacaaaaaaaaacccacaaaaaaccccaagaaaaccgaccccttttattgctgtaaaacaatatagctgcgagcgccactttcgcgattctcctttgacacaaagcaggaggcgggggggctccgggagctctgggcccccttttgccagttattaactagcggtagtggaacgcaatagcttctgtaaaacatgactgtgaaatcctctccctctctgtctttctctctcttctttccgggggcgtggggggtgggttggttaacatagctttcagcgctagaggagttatgtgatattacatttgtgcactttttttttgttggttttttttttaaattttgggtctctagttggttatttccccattcctgttttttttttttttattattattatttttgttgtggtttatctgtgtgtactggaggtagctgttgagacaaacatcccaacaacatgaaactgcctatttatgctgtagttatctctctttctctctcttca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]