LOCUS       XM_041010862             654 bp    mRNA    linear   PLN 19-APR-2021
DEFINITION  PREDICTED: Glycine max uncharacterized LOC100306572 (LOC100306572),
            transcript variant X2, mRNA.
ACCESSION   XM_041010862
VERSION     XM_041010862.1
DBLINK      BioProject: PRJNA48389
KEYWORDS    RefSeq.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_038253.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Glycine max Annotation Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Glycine max"
                     /mol_type="mRNA"
                     /cultivar="Williams 82"
                     /db_xref="taxon:3847"
                     /chromosome="17"
                     /tissue_type="callus"
     gene            1..654
                     /gene="LOC100306572"
                     /note="uncharacterized LOC100306572; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     ESTs, 11 long SRA reads, 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:100306572"
     CDS             170..520
                     /gene="LOC100306572"
                     /codon_start=1
                     /product="uncharacterized protein LOC100306572 isoform X2"
                     /protein_id="XP_040866796.1"
                     /db_xref="GeneID:100306572"
                     /translation="

MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTYPSLL"

     misc_feature    272..502
                     /gene="LOC100306572"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:429250"
ORIGIN      

ctttgaccgcttatatatacgcacgaatcacaaatcgtaacattggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagttacatattattcgagtagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacgtatccttctcttttataatacttgttgatctccaggagaatattcttgaagcttttttctccagagcttattattgaagatctttgttttgtaagatagagtgaattgctcttctaaaaaaaaatatatatgatagattgcaatttaccaaa

//