LOCUS       XM_040901196             546 bp    mRNA    linear   PLN 20-APR-2021
DEFINITION  Laetiporus sulphureus 93-53 uncharacterized protein
            (LAESUDRAFT_109092), mRNA.
ACCESSION   XM_040901196
VERSION     XM_040901196.1
DBLINK      BioProject: PRJNA721992
            BioSample: SAMN02745959
KEYWORDS    RefSeq.
SOURCE      Laetiporus sulphureus 93-53
  ORGANISM  Laetiporus sulphureus 93-53
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Polyporales; Laetiporus.
REFERENCE   1  (bases 1 to 546)
  AUTHORS   Nagy,L.G., Riley,R., Tritt,A., Adam,C., Daum,C., Floudas,D.,
            Sun,H., Yadav,J.S., Pangilinan,J., Larsson,K.H., Matsuura,K.,
            Barry,K., Labutti,K., Kuo,R., Ohm,R.A., Bhattacharya,S.S.,
            Shirouzu,T., Yoshinaga,Y., Martin,F.M., Grigoriev,I.V. and
            Hibbett,D.S.
  TITLE     Comparative Genomics of Early-Diverging Mushroom-Forming Fungi
            Provides Insights into the Origins of Lignocellulose Decay
            Capabilities
  JOURNAL   Mol. Biol. Evol. 33 (4), 959-970 (2016)
   PUBMED   26659563
REFERENCE   2  (bases 1 to 546)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 546)
  AUTHORS   Riley,R., Sun,H., Nagy,L.G., Tritt,A., Adam,C., Daum,C.,
            Floudas,D., Yadav,J., Pangilinan,J., Larsson,K.-H., Matsuura,K.,
            Barry,K., Labutti,K., Kuo,R., Ohm,R., Bhattacharya,S., Shirozou,T.,
            Yoshinaga,Y., Martin,F.M., Hibbett,D.S., Grigoriev,I.V.,
            Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (06-NOV-2015) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024468524).
            
            ##Metadata-START##
            Organism Display Name :: Laetiporus sulphureus 93-53
            GOLD Stamp ID         :: Gp0025315
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..546
                     /organism="Laetiporus sulphureus 93-53"
                     /mol_type="mRNA"
                     /strain="93-53"
                     /db_xref="taxon:1314785"
                     /chromosome="Unknown"
     gene            1..546
                     /locus_tag="LAESUDRAFT_109092"
                     /db_xref="GeneID:63818228"
     CDS             52..339
                     /locus_tag="LAESUDRAFT_109092"
                     /note="expressed protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_040765133.1"
                     /db_xref="GeneID:63818228"
                     /db_xref="JGIDB:Laesu1_109092"
                     /translation="

MPNNVNASTQVQKPHSRQNSTSVLWGHLLSKDSITPALARNSASSYNSSIPPIAPADKTGTTGNYSWDERELDNLRGLLYLAGMMAHSYGTLNCL"

ORIGIN      

cactgctaacctcaaacgctgaccccgaggagccctgaggtccgtctcgatatgcccaacaacgttaacgcatccactcaagtgcaaaaaccgcacagtcgccagaattctacgtctgtgctgtggggtcatctcctctcgaaggacagcatcactcccgcactcgctcgaaatagtgcttcatcttacaattcctcaattcctcccatcgcaccggcagacaagacaggaacgacggggaactactcctgggatgaaagggaacttgacaatttgcgcggcttactttaccttgctgggatgatggctcactcttacggcaccttgaactgcctgtagtcctctatcattctgatcgaatgcggtcaacgctccaatcgctgcctgagaataagtctaccaggctacagcgggctgtctgatatgtcggttgccaaacgtcgcgacagacgtatgctcttgcgattgtcgtgtgcaattactcccagagcgaaccgccatttgcaccgatcatcgacatcgtatttgaagagacgtgtaagcgag

//