2024-05-20 06:38:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_040259896 714 bp mRNA linear MAM 20-MAR-2021 DEFINITION PREDICTED: Oryx dammah leucine zipper protein 6 (LUZP6), mRNA. ACCESSION XM_040259896 VERSION XM_040259896.1 DBLINK BioProject: PRJNA694191 KEYWORDS RefSeq; corrected model; includes ab initio. SOURCE Oryx dammah (scimitar-horned oryx) ORGANISM Oryx dammah Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Hippotraginae; Oryx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024070202.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Oryx dammah Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 3% of CDS bases frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-27 JABAEV010000018.1 99771154-99771180 c 28-108 JABAEV010000018.1 99770439-99770519 c 109-110 "NN" 1-2 111-714 JABAEV010000018.1 99769835-99770438 c FEATURES Location/Qualifiers source 1..714 /organism="Oryx dammah" /mol_type="mRNA" /isolate="SB20612" /db_xref="taxon:59534" /chromosome="Unknown" /sex="male" /tissue_type="liver" /dev_stage="adult" /country="USA: Front Royal, Virginia" gene 1..714 /gene="LUZP6" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 40 long SRA reads, 1 Protein, and 94% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:120877548" CDS 1..183 /gene="LUZP6" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: leucine zipper protein 6" /protein_id="XP_040115830.1" /db_xref="GeneID:120877548" /translation="
MQAIRVGLEFYIKSVFLYALFQVKTGGLPVYISILTXSPLQLQTGIRRLTVQLTAPESTQ"
ORIGIN
atgcaggctattcgagttggattagaattttatattaagtcagtctttttatatgcactatttcaagtgaaaacaggtggtttacctgtctacattagcatcctaacannttcccccttgcagcttcagactggcatccgcagacttacagttcagctcacggccccggaatcgacccagtagttctctgcacagctcaccttctaaaccagtggggcctgaaggagaagtaggtggatgccacgggtggaagctgccagcaagcaggcccttccttcattgatttccttcccccaaataatggatttcaaatctatatgtacctatttgatttttttcccctaaaacttcaactaagctgctgttttcttccatgcaatattgtatactcgattgtgtatagaagaagctggtgagagtgccctcctacataagcaattgcagtgtttgcatgcaaaattttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccacagtgtaatacatttgacacagttgggtttctcttattatcctagttcatgtacatcagaatgctaaataatactgtgttttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]