GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 06:38:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_040259896             714 bp    mRNA    linear   MAM 20-MAR-2021
DEFINITION  PREDICTED: Oryx dammah leucine zipper protein 6 (LUZP6), mRNA.
ACCESSION   XM_040259896
VERSION     XM_040259896.1
DBLINK      BioProject: PRJNA694191
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Oryx dammah (scimitar-horned oryx)
  ORGANISM  Oryx dammah
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Hippotraginae; Oryx.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024070202.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Oryx dammah Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio   :: 3% of CDS bases
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-27                JABAEV010000018.1  99771154-99771180   c
            28-108              JABAEV010000018.1  99770439-99770519   c
            109-110             "NN"               1-2
            111-714             JABAEV010000018.1  99769835-99770438   c
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Oryx dammah"
                     /mol_type="mRNA"
                     /isolate="SB20612"
                     /db_xref="taxon:59534"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="liver"
                     /dev_stage="adult"
                     /country="USA: Front Royal, Virginia"
     gene            1..714
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 40 long SRA reads, 1 Protein, and 94%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:120877548"
     CDS             1..183
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: leucine zipper protein 6"
                     /protein_id="XP_040115830.1"
                     /db_xref="GeneID:120877548"
                     /translation="
MQAIRVGLEFYIKSVFLYALFQVKTGGLPVYISILTXSPLQLQTGIRRLTVQLTAPESTQ"
ORIGIN      
atgcaggctattcgagttggattagaattttatattaagtcagtctttttatatgcactatttcaagtgaaaacaggtggtttacctgtctacattagcatcctaacannttcccccttgcagcttcagactggcatccgcagacttacagttcagctcacggccccggaatcgacccagtagttctctgcacagctcaccttctaaaccagtggggcctgaaggagaagtaggtggatgccacgggtggaagctgccagcaagcaggcccttccttcattgatttccttcccccaaataatggatttcaaatctatatgtacctatttgatttttttcccctaaaacttcaactaagctgctgttttcttccatgcaatattgtatactcgattgtgtatagaagaagctggtgagagtgccctcctacataagcaattgcagtgtttgcatgcaaaattttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccacagtgtaatacatttgacacagttgggtttctcttattatcctagttcatgtacatcagaatgctaaataatactgtgttttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]