2024-05-17 03:45:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039966929 309 bp mRNA linear PLN 09-MAR-2021 DEFINITION PREDICTED: Panicum virgatum protein FLORAL ORGAN NUMBER2-like (LOC120685088), mRNA. ACCESSION XM_039966929 VERSION XM_039966929.1 DBLINK BioProject: PRJNA704030 KEYWORDS RefSeq; includes ab initio. SOURCE Panicum virgatum (switchgrass) ORGANISM Panicum virgatum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum; Panicum sect. Hiantes. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_053152.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Panicum virgatum Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..309 /organism="Panicum virgatum" /mol_type="mRNA" /strain="AP13" /db_xref="taxon:38727" /chromosome="8N" gene 1..309 /gene="LOC120685088" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:120685088" CDS 1..309 /gene="LOC120685088" /codon_start=1 /product="protein FLORAL ORGAN NUMBER2-like" /protein_id="XP_039822863.1" /db_xref="GeneID:120685088" /translation="
MAPRSLLCLAAAACCCLALLVPPAQGRLGIGLPGGFGATTNRRTSEQQRGTAAKAASTAWSSSWTAAAAGRVRPELRSVPGGPDPLHHHGSPWRPELEPTTP"
ORIGIN
atggcaccacggtccctcctgtgcttggcggcggcggcgtgctgctgcctcgcgttgctggttcctccggcgcaggggcgccttggcattggtctgcctggtggatttggtgcgacgacgaaccggcggacctcggagcagcagcgcggcacggcagcgaaggccgcgtcgacggcgtggtcatcgtcgtggacggcggcggcggctgggagggtgaggccggagctgcggtcggtgccggggggcccggacccgctgcaccaccacggcagcccgtggcggccggagctggagccgaccaccccctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]