LOCUS       XM_037999020            1122 bp    mRNA    linear   PRI 01-DEC-2020
DEFINITION  PREDICTED: Chlorocebus sabaeus copper chaperone for superoxide
            dismutase (CCS), transcript variant X2, mRNA.
ACCESSION   XM_037999020
VERSION     XM_037999020.1
DBLINK      BioProject: PRJNA680339
KEYWORDS    RefSeq.
SOURCE      Chlorocebus sabaeus (Cercopithecus sabaeus)
  ORGANISM  Chlorocebus sabaeus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_023666038.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Chlorocebus sabaeus Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1122
                     /organism="Chlorocebus sabaeus"
                     /mol_type="mRNA"
                     /strain="WHO RCB 10-87"
                     /db_xref="taxon:60711"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="kidney epithelium"
     gene            1..1122
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 126 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     40 samples with support for all annotated introns"
                     /db_xref="GeneID:103221941"
     CDS             193..960
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_037854948.1"
                     /db_xref="GeneID:103221941"
                     /translation="

MTCQSCVDAVRKSLQGVAGVQDVEVHLENQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSDQLQNLGAAVAILGGPGTVQGVVRFLQLSPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGDHFNPDGASHGGPQDSDRHRGDLGNVHADADGCAIFRMEDEKLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGQRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESVQPPAHL"

     misc_feature    193..894
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      

cggagttaagggtgtctttcgaggctcagtccccgcgacgccggctggttggtgctcctgcgcctgaagagttctgcgtttcgggctggtgactgggtccagaatggcttcggactcggggaaccaggggaccctctgcacgcgatcatcggtcggtccctgccgcccttgcagttggagttcgcggtgcagatgacctgtcagagctgtgtggacgcggtgcgcaagtccctgcaaggggtggcaggtgtccaggatgtggaggtgcacttggagaatcagatggtcttggtacacaccactctgcctagccaggaggtgcaggctctcctggaaggcacggggcggcaggcagtactcaagggcatgggcagcgaccagttgcagaatctgggggcagcagtggccatcctgggagggcctggcaccgtgcagggggtggtgcgcttcttacagctgagccctgagcgctgcctcatcgaaggaactattgacggcctggagcctgggctgcatggactccatgtccatcagtatggggacctcacaaacaactgcaacagctgtggggaccactttaaccctgatggagcatctcatgggggcccccaggactctgaccggcaccgcggagacctgggcaatgtccatgctgatgctgacggctgcgccatcttcagaatggaggatgagaagctgaaggtgtgggatgtgattggccgcagcctggttattgatgagggagaagatgacctaggccggggaggccatcccttatccaagatcacagggaactctgggcagaggttggcctgcggcatcatcgcacgctctgctggcctcttccagaaccccaagcagatctgctcttgcgatggcctcaccatctgggaggagcgaggccggcccatcgctggcaagggccgaaaggagtcagtccagccccctgcccacctttgagcaggacctcaccttggctctgttgctgtcctccagggcgagcactttcctcttccagagggggccagagggaccttgcctgcccagtctttggagagctcagtacagggcaggagctgctgcggtgttcccttggcaaatgagttttattttcatttggga

//