LOCUS       XM_037679163             654 bp    mRNA    linear   VRT 29-JUL-2021
DEFINITION  PREDICTED: Nematolebias whitei ADP-ribosylation factor related
            protein 1 (arfrp1), transcript variant X2, mRNA.
ACCESSION   XM_037679163
VERSION     XM_037679163.1
DBLINK      BioProject: PRJNA678356
KEYWORDS    RefSeq.
SOURCE      Nematolebias whitei (Rio pearlfish)
  ORGANISM  Nematolebias whitei
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Rivulidae; Nematolebias.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_023618552.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Updated annotation
            Annotation Name             :: Nematolebias whitei Updated
                                           Annotation Release 100.20210725
            Annotation Version          :: 100.20210725
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; propagated
                                           RefSeq model
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Nematolebias whitei"
                     /mol_type="mRNA"
                     /isolate="Nwh7"
                     /db_xref="taxon:451745"
                     /chromosome="7"
                     /sex="female"
                     /tissue_type="liver"
                     /dev_stage="adult"
                     /country="Brazil: Barra de Sao Joao"
     gene            1..654
                     /gene="arfrp1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:119412185"
     CDS             101..565
                     /gene="arfrp1"
                     /codon_start=1
                     /product="ADP-ribosylation factor-related protein 1
                     isoform X2"
                     /protein_id="XP_037535091.1"
                     /db_xref="GeneID:119412185"
                     /translation="

MSLSKITTTVGLNIGTIDVGKARLMFWDLGGQDELQSLWDKYYAESHGVIYVIDSTDEDRLSESKEAFEKMISSEALEGVPLLVLANKQDVPNCLSVPDIKTAFSDCAPKIGKRDCLVQPCTALTGDGVNDGIEWMVKCVVRNIHRPPRQKDIT"

     misc_feature    101..517
                     /gene="arfrp1"
                     /note="Arf-related protein 1 (Arfrp1); Region: Arfrp1;
                     cd04160"
                     /db_xref="CDD:206725"
     misc_feature    order(125..139,152..154,182..184,194..196,212..214,
                     218..226)
                     /gene="arfrp1"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206725"
     misc_feature    125..127
                     /gene="arfrp1"
                     /note="G2 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(128..151,179..181,212..214,221..226)
                     /gene="arfrp1"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206725"
     misc_feature    order(137..157,164..181)
                     /gene="arfrp1"
                     /note="interswitch region [active]"
                     /db_xref="CDD:206725"
     misc_feature    182..235
                     /gene="arfrp1"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206725"
     misc_feature    182..193
                     /gene="arfrp1"
                     /note="G3 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    359..370
                     /gene="arfrp1"
                     /note="G4 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    464..472
                     /gene="arfrp1"
                     /note="G5 box; other site"
                     /db_xref="CDD:206725"
ORIGIN      

gggtggacccagatatctttgagcatcaggaacgacggaaaaaaggaagacgacctttctggagcagacaaagacccggttcagtaagaattacaaggggatgagtttatcaaagatcacaacaacagtcggtctgaacatcggtaccatcgatgtaggcaaagctcgtctcatgttctgggacctgggaggtcaggatgagctgcagtctctgtgggacaaatactacgccgagtcccacggagtcatctatgtgatcgattcaaccgacgaagaccgtctgtcagaatcgaaggaggcctttgagaagatgatcagcagcgaagcgttggaaggcgttccactcctggttctggccaacaagcaggatgttccgaactgtttgtcagtcccggacattaaaacagcctttagtgactgcgcaccaaagatcggcaaaagagactgtttggtccagccctgtaccgccctaacgggggacggagtgaacgacggcatcgagtggatggtgaagtgtgtggtccggaacattcaccggccgcctaggcagaaggacattacctaaaacctcctggttctgaccgtgggctgagaacgctcgaacaacccgttctgtgtttggactgcttctgattttattccagtttcatgagg

//