GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 13:17:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_037314182             279 bp    mRNA    linear   PLN 09-NOV-2020
DEFINITION  Letharia columbiana uncharacterized protein (HO173_012310), partial
            mRNA.
ACCESSION   XM_037314182
VERSION     XM_037314182.1
DBLINK      BioProject: PRJNA670756
            BioSample: SAMN14934069
KEYWORDS    RefSeq.
SOURCE      Letharia columbiana
  ORGANISM  Letharia columbiana
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Lecanoromycetes; OSLEUM clade; Lecanoromycetidae; Lecanorales;
            Lecanorineae; Parmeliaceae; Letharia.
REFERENCE   1  (bases 1 to 279)
  AUTHORS   McKenzie,S.K., Walston,R.F. and Allen,J.L.
  TITLE     Complete, high-quality genomes from long-read metagenomic
            sequencing of two wolf lichen thalli reveals enigmatic genome
            architecture
  JOURNAL   Genomics 112 (5), 3150-3156 (2020)
   PUBMED   32504651
REFERENCE   2  (bases 1 to 279)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 279)
  AUTHORS   Mckenzie,S.K., Walston,R.F. and Allen,J.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2020) Department of Biology, Eastern Washington
            University, Science Building 258, Cheney, WA 99004, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_023501122).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..279
                     /organism="Letharia columbiana"
                     /mol_type="mRNA"
                     /isolate="WasteWater2"
                     /isolation_source="In branches"
                     /db_xref="taxon:112416"
                     /chromosome="Unknown"
                     /country="USA: Cheney, WA"
                     /lat_lon="47.4797 N 117.5607 W"
                     /collection_date="2018"
     gene            <1..>279
                     /locus_tag="HO173_012310"
                     /db_xref="GeneID:59293946"
     CDS             1..279
                     /locus_tag="HO173_012310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037158957.1"
                     /db_xref="GeneID:59293946"
                     /translation="
MPPPRHNVTGFDPRKFVQSSGMPAKDPWARAEQWRYTGPFTRYNRFKGALPGLGTATVAFGAYCTYEYFFMKDEHHGHGEGHGEGHGSEEHH"
     misc_feature    73..219
                     /locus_tag="HO173_012310"
                     /note="NADH-ubiquinone oxidoreductase B12 subunit family;
                     Region: NDUF_B12; pfam08122"
                     /db_xref="CDD:429829"
ORIGIN      
atgcctcctcctcgacacaatgtgaccggctttgatcctcgcaaatttgtacagtcgtctggcatgccagctaaggatccatgggcgcgagctgaacaatggcgatatacgggtccctttacaagatacaaccggttcaagggcgctctccctggtctaggcactgctacggtagctttcggggcttactgcacctacgagtactttttcatgaaagacgagcatcatgggcatggggaaggacatggggaaggacatggaagcgaagagcatcattga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]