2024-05-18 13:17:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_037314182 279 bp mRNA linear PLN 09-NOV-2020 DEFINITION Letharia columbiana uncharacterized protein (HO173_012310), partial mRNA. ACCESSION XM_037314182 VERSION XM_037314182.1 DBLINK BioProject: PRJNA670756 BioSample: SAMN14934069 KEYWORDS RefSeq. SOURCE Letharia columbiana ORGANISM Letharia columbiana Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Lecanoromycetes; OSLEUM clade; Lecanoromycetidae; Lecanorales; Lecanorineae; Parmeliaceae; Letharia. REFERENCE 1 (bases 1 to 279) AUTHORS McKenzie,S.K., Walston,R.F. and Allen,J.L. TITLE Complete, high-quality genomes from long-read metagenomic sequencing of two wolf lichen thalli reveals enigmatic genome architecture JOURNAL Genomics 112 (5), 3150-3156 (2020) PUBMED 32504651 REFERENCE 2 (bases 1 to 279) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (09-NOV-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 279) AUTHORS Mckenzie,S.K., Walston,R.F. and Allen,J.L. TITLE Direct Submission JOURNAL Submitted (17-MAY-2020) Department of Biology, Eastern Washington University, Science Building 258, Cheney, WA 99004, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_023501122). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..279 /organism="Letharia columbiana" /mol_type="mRNA" /isolate="WasteWater2" /isolation_source="In branches" /db_xref="taxon:112416" /chromosome="Unknown" /country="USA: Cheney, WA" /lat_lon="47.4797 N 117.5607 W" /collection_date="2018" gene <1..>279 /locus_tag="HO173_012310" /db_xref="GeneID:59293946" CDS 1..279 /locus_tag="HO173_012310" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_037158957.1" /db_xref="GeneID:59293946" /translation="
MPPPRHNVTGFDPRKFVQSSGMPAKDPWARAEQWRYTGPFTRYNRFKGALPGLGTATVAFGAYCTYEYFFMKDEHHGHGEGHGEGHGSEEHH"
misc_feature 73..219 /locus_tag="HO173_012310" /note="NADH-ubiquinone oxidoreductase B12 subunit family; Region: NDUF_B12; pfam08122" /db_xref="CDD:429829" ORIGIN
atgcctcctcctcgacacaatgtgaccggctttgatcctcgcaaatttgtacagtcgtctggcatgccagctaaggatccatgggcgcgagctgaacaatggcgatatacgggtccctttacaagatacaaccggttcaagggcgctctccctggtctaggcactgctacggtagctttcggggcttactgcacctacgagtactttttcatgaaagacgagcatcatgggcatggggaaggacatggggaaggacatggaagcgaagagcatcattga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]