LOCUS       XM_036201456             921 bp    mRNA    linear   ROD 23-SEP-2020
DEFINITION  PREDICTED: Onychomys torridus copper chaperone for superoxide
            dismutase (Ccs), transcript variant X2, mRNA.
ACCESSION   XM_036201456
VERSION     XM_036201456.1
DBLINK      BioProject: PRJNA664182
KEYWORDS    RefSeq.
SOURCE      Onychomys torridus (southern grasshopper mouse)
  ORGANISM  Onychomys torridus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Neotominae; Onychomys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_050443.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Onychomys torridus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..921
                     /organism="Onychomys torridus"
                     /mol_type="mRNA"
                     /db_xref="taxon:38674"
                     /chromosome="1"
     gene            1..921
                     /gene="Ccs"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 12 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:118592453"
     CDS             120..809
                     /gene="Ccs"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_036057349.1"
                     /db_xref="GeneID:118592453"
                     /translation="

MASDSGDGGTMCALEFAVQMTCQSCVDSVRRTLQGVTENLGAAVAILEGQNAIQGVVRFLQLTSELCLIEGTVDGLPPGLHGFHVHQYGDLTRDCNSCGDHFNPDGTSHGGPQDTDRHRGDLGNILAEADGRSTFRIEDKQLKVWDVIGRSLVIDEGEDDLGRGNHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGEGRKDSSAQPPAHL"

     misc_feature    162..>281
                     /gene="Ccs"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(177..185,192..194)
                     /gene="Ccs"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    order(249..251,255..257,285..287,291..293,381..389,
                     561..566)
                     /gene="Ccs"
                     /note="E-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    276..671
                     /gene="Ccs"
                     /note="Copper/zinc superoxide dismutase (SODC); Region:
                     Sod_Cu; pfam00080"
                     /db_xref="CDD:425456"
     misc_feature    order(321..323,495..497)
                     /gene="Ccs"
                     /note="P-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    order(369..371,375..377,420..422,471..473,480..482,
                     582..584)
                     /gene="Ccs"
                     /note="active site"
                     /db_xref="CDD:238186"
     misc_feature    order(369..371,375..377,420..422,582..584)
                     /gene="Ccs"
                     /note="Cu2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
     misc_feature    order(420..422,444..446,471..473,480..482)
                     /gene="Ccs"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
ORIGIN      

cgcgccaaggaggtggagcgaagggtggctcctgaggctccgcccaccccacaagactgagtggtgttggtctctggaccctagttgttttgctgctcaggcagttgactacatcccagatggcttcggattccggggacggtgggacaatgtgcgcgctggagtttgcagtgcagatgacctgtcagagctgtgtggactcggtgcgcaggaccctgcaaggggtgacagagaacctaggagcagcagtagccattctggagggccagaacgccatacagggtgtggtccgcttcctacagctgacctctgagctctgcctgattgagggaaccgttgatggcctgccgcctgggctgcatgggttccatgtccatcagtatggggatctcacaagggattgcaatagctgtggggaccattttaaccctgatggaacatctcatgggggccctcaggacactgatcggcaccggggagatctgggcaacatcctggctgaggctgacggccgatccaccttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagcctggttattgatgagggagaagatgacctgggccggggaaaccatccgttatccaagatcacaggcaactctggcaagaggttggcctgtggcatcatagcacgctctgctggcctcttccagaatcccaagcagatctgttcctgtgatggcctcactatctgggaggagcgaggcaggcccattgctggtgaaggccgaaaagactcctcagcccagccccctgctcacctctgatcagggcctcatctcaggttattttgtcccccggctgaatgtctacccgcagaggggacagggtaggggttgctgtatccttagcaaattaaatagttattttcatatagta

//