2024-05-16 17:28:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_035975100 534 bp mRNA linear PLN 01-SEP-2020 DEFINITION PREDICTED: Helianthus annuus protein CLAVATA 3-like (LOC118480319), mRNA. ACCESSION XM_035975100 VERSION XM_035975100.1 DBLINK BioProject: PRJNA396063 KEYWORDS RefSeq. SOURCE Helianthus annuus (common sunflower) ORGANISM Helianthus annuus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_035439.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Helianthus annuus Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..534 /organism="Helianthus annuus" /mol_type="mRNA" /cultivar="XRQ/B" /specimen_voucher="SF193" /db_xref="taxon:4232" /chromosome="7" /tissue_type="leaves" /dev_stage="4 leaves" /country="France" /collected_by="INRA, LIPM" gene 1..534 /gene="LOC118480319" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:118480319" CDS 52..357 /gene="LOC118480319" /codon_start=1 /product="protein CLAVATA 3-like" /protein_id="XP_035830993.1" /db_xref="GeneID:118480319" /translation="
MAFEPKSLSVSFLLLLCLFLVLQLSDGAEATTLYNGSILKDISNRKLLVVNGLEAKEAVLNMGGKSKKEEEEEEGWELRAAPLGPDPLHHHGADPQKPRTP"
ORIGIN
accagacaaaaccaaatcttctcttccatacacacaaaaaaaaaaaaactcatggctttcgaacccaaatcactttctgtgtccttccttttgctgctgtgcttgtttcttgtgctgcaactctctgatggtgccgaagcaaccaccctctacaatggttccattctgaaagatatcagtaataggaagttattggtggtgaatggtttggaagcaaaagaagcagtgttgaacatgggtggcaagagtaaaaaagaggaggaagaggaggagggttgggagctaagggcagcaccattgggtccagacccacttcaccatcacggtgccgacccccaaaagccacgcaccccttgatcatgccttgtcttttttgactgttaagtgcatctgctcagctggcgagctatggatgaagtcgttggttaactttttgatctttattaattaatttgtagtttcttataacgtgtagtatgtatagttgcagaatgtcatggtagttttagtggttaagatcagtgttttgttggt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]