GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 12:30:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_035802854            1259 bp    mRNA    linear   INV 13-AUG-2020
DEFINITION  PREDICTED: Branchiostoma floridae UPF0711 protein C18orf21 homolog
            (LOC118403955), mRNA.
ACCESSION   XM_035802854
VERSION     XM_035802854.1
DBLINK      BioProject: PRJNA33245
KEYWORDS    RefSeq.
SOURCE      Branchiostoma floridae (Florida lancelet)
  ORGANISM  Branchiostoma floridae
            Eukaryota; Metazoa; Chordata; Cephalochordata; Leptocardii;
            Amphioxiformes; Branchiostomatidae; Branchiostoma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_049994.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Branchiostoma floridae Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1259
                     /organism="Branchiostoma floridae"
                     /mol_type="mRNA"
                     /strain="S238N-H82"
                     /db_xref="taxon:7739"
                     /chromosome="16"
                     /sex="male"
                     /tissue_type="testes"
                     /country="USA: Old Tampa Bay, Florida"
     gene            1..1259
                     /gene="LOC118403955"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 10 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:118403955"
     CDS             53..775
                     /gene="LOC118403955"
                     /codon_start=1
                     /product="UPF0711 protein C18orf21 homolog"
                     /protein_id="XP_035658747.1"
                     /db_xref="GeneID:118403955"
                     /translation="
MSREKDVSRTCYLQQLASACSDTCPPLSRFLLHTAGSGSEGNHAAQSMPSHMTCQSCGNLLLPGNHTVRLRPKRKMTSAVRRVISKVSKGQMASAAEVKLLKRYQDRKNHVIVQCTVCQGKAVIPAATRKHVVMATSASPGSLAGTPVVSRRIAKATRRLVSTPQSHSSPILSTPGSSMMVAGSSPRTPDSSLRVGSSGPGSSGRKGKHQKQRHAQLKHMLSQQSLGDTSISLSDFLQSL"
     misc_feature    209..727
                     /gene="LOC118403955"
                     /note="Domain of unknown function (DUF4674); Region:
                     DUF4674; pfam15719"
                     /db_xref="CDD:434882"
ORIGIN      
cagggacacaacccacatcaacaaactcaggactttccatgatgaagtcagtatgagcagagaaaaggacgtctccagaacatgctatctgcagcagctcgcctccgcatgttcagacacatgcccgccactctccaggttcctattgcatacggctgggtctggcagtgagggaaaccatgcagctcagagcatgccgagtcatatgacctgtcagtcatgtggaaacttattgttacctggcaaccacacggtgaggttacgacccaaaaggaaaatgacctcagctgtccgacgtgtcatatcaaaggtcagcaagggtcagatggcatcggctgcagaggtcaagctactcaagagataccaagacaggaaaaaccatgtgattgttcagtgtacagtctgtcagggcaaggccgtcatcccagcagccaccaggaaacacgttgtcatggcaacatcggcatcacctggaagcttagcaggaactccagtggtgtccaggagaattgccaaggcaacccgaagacttgtgtccactcctcaatcccacagttctccaatcctgagcaccccaggctcgagtatgatggttgcgggttcgagtcccagaactcctgactccagtctgagggttgggagttcgggtcccggctcttccggcaggaaaggaaagcatcagaaacagagacacgcccagctgaaacacatgctatcccagcagtccctgggagacaccagcatttccctttcggactttctacagtctttatgacagtttgttttagaaaattatcatgatacctacaactcatggcattcccttctctgactttctccagtctttatgacattgtgttgtaaaaaatgataatcatactcataactaatttggtaacaagatggctagatagttaagacctttagaagtggtaagaaatatacatttttgtccatatcttcattatatactactttgcaccacaaatgctatttcagattacatttactgtctacagagttccctaccaaggcattctgatttatgatatgtgttagatttatgtatagttgtagaagaccttacaaaagtcactatacttttgttgtattaataaagattgtttgtttattgatcaggctctcaatctctgcaatgcatagcaatgcaaaaaagtgaataatttaaaataaattaattagctactaagtcttttacaatgcatgtatgaaattactgaattaaaagcaaggtggta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]