2024-05-19 12:30:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_035802854 1259 bp mRNA linear INV 13-AUG-2020 DEFINITION PREDICTED: Branchiostoma floridae UPF0711 protein C18orf21 homolog (LOC118403955), mRNA. ACCESSION XM_035802854 VERSION XM_035802854.1 DBLINK BioProject: PRJNA33245 KEYWORDS RefSeq. SOURCE Branchiostoma floridae (Florida lancelet) ORGANISM Branchiostoma floridae Eukaryota; Metazoa; Chordata; Cephalochordata; Leptocardii; Amphioxiformes; Branchiostomatidae; Branchiostoma. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_049994.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Branchiostoma floridae Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1259 /organism="Branchiostoma floridae" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:7739" /chromosome="16" /sex="male" /tissue_type="testes" /country="USA: Old Tampa Bay, Florida" gene 1..1259 /gene="LOC118403955" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns" /db_xref="GeneID:118403955" CDS 53..775 /gene="LOC118403955" /codon_start=1 /product="UPF0711 protein C18orf21 homolog" /protein_id="XP_035658747.1" /db_xref="GeneID:118403955" /translation="
MSREKDVSRTCYLQQLASACSDTCPPLSRFLLHTAGSGSEGNHAAQSMPSHMTCQSCGNLLLPGNHTVRLRPKRKMTSAVRRVISKVSKGQMASAAEVKLLKRYQDRKNHVIVQCTVCQGKAVIPAATRKHVVMATSASPGSLAGTPVVSRRIAKATRRLVSTPQSHSSPILSTPGSSMMVAGSSPRTPDSSLRVGSSGPGSSGRKGKHQKQRHAQLKHMLSQQSLGDTSISLSDFLQSL"
misc_feature 209..727 /gene="LOC118403955" /note="Domain of unknown function (DUF4674); Region: DUF4674; pfam15719" /db_xref="CDD:434882" ORIGIN
cagggacacaacccacatcaacaaactcaggactttccatgatgaagtcagtatgagcagagaaaaggacgtctccagaacatgctatctgcagcagctcgcctccgcatgttcagacacatgcccgccactctccaggttcctattgcatacggctgggtctggcagtgagggaaaccatgcagctcagagcatgccgagtcatatgacctgtcagtcatgtggaaacttattgttacctggcaaccacacggtgaggttacgacccaaaaggaaaatgacctcagctgtccgacgtgtcatatcaaaggtcagcaagggtcagatggcatcggctgcagaggtcaagctactcaagagataccaagacaggaaaaaccatgtgattgttcagtgtacagtctgtcagggcaaggccgtcatcccagcagccaccaggaaacacgttgtcatggcaacatcggcatcacctggaagcttagcaggaactccagtggtgtccaggagaattgccaaggcaacccgaagacttgtgtccactcctcaatcccacagttctccaatcctgagcaccccaggctcgagtatgatggttgcgggttcgagtcccagaactcctgactccagtctgagggttgggagttcgggtcccggctcttccggcaggaaaggaaagcatcagaaacagagacacgcccagctgaaacacatgctatcccagcagtccctgggagacaccagcatttccctttcggactttctacagtctttatgacagtttgttttagaaaattatcatgatacctacaactcatggcattcccttctctgactttctccagtctttatgacattgtgttgtaaaaaatgataatcatactcataactaatttggtaacaagatggctagatagttaagacctttagaagtggtaagaaatatacatttttgtccatatcttcattatatactactttgcaccacaaatgctatttcagattacatttactgtctacagagttccctaccaaggcattctgatttatgatatgtgttagatttatgtatagttgtagaagaccttacaaaagtcactatacttttgttgtattaataaagattgtttgtttattgatcaggctctcaatctctgcaatgcatagcaatgcaaaaaagtgaataatttaaaataaattaattagctactaagtcttttacaatgcatgtatgaaattactgaattaaaagcaaggtggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]