GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 15:21:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_034778104            1968 bp    mRNA    linear   VRT 31-MAY-2020
DEFINITION  PREDICTED: Trachemys scripta elegans ST6 N-acetylgalactosaminide
            alpha-2,6-sialyltransferase 5 (ST6GALNAC5), transcript variant X6,
            mRNA.
ACCESSION   XM_034778104
VERSION     XM_034778104.1
DBLINK      BioProject: PRJNA634151
KEYWORDS    RefSeq.
SOURCE      Trachemys scripta elegans
  ORGANISM  Trachemys scripta elegans
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Testudinata; Testudines; Cryptodira; Durocryptodira;
            Testudinoidea; Emydidae; Trachemys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_048305.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Trachemys scripta elegans Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1968
                     /organism="Trachemys scripta elegans"
                     /mol_type="mRNA"
                     /isolate="TJP31775"
                     /isolation_source="river"
                     /sub_species="elegans"
                     /db_xref="taxon:31138"
                     /chromosome="8"
                     /country="USA"
                     /collection_date="14-Feb-2018"
     gene            1..1968
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:117881191"
     CDS             248..1030
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5 isoform X5"
                     /protein_id="XP_034633995.1"
                     /db_xref="GeneID:117881191"
                     /translation="
MKTLMRHGLAVCLVLTTMCTSLLLMYSSIGGGGPKEPSQQQQQVAVAASGKPETEPSGSSQQRRRLPVGAGLLEGYISVLDHKPLKMHCKSCALVTSSGHLLGSKQGNRIDQTECVIRMNDAPSRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSQGTVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKVYMVSRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRFSSR"
     misc_feature    503..1006
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      
aggtggcagttgtgtagatcactgagagactaagagggtccagtccagttttaattctgtctctaatctctgccacagcagtgctttccccaacagccccagctcgggcgtctctgtctctctctctctctctccagcctgatccacagcaaaaacatgccactggcttcctcacaatggaaaccctagagggaaaagtggccccagatgcgcaagcctgaggattcggtacaaagaggtgcacaacatgaagaccctgatgcgccatgggctggcggtgtgtttagtgctcaccaccatgtgcaccagcttgttgctcatgtacagcagcatcggcggcgggggcccgaaagagccgagccagcagcagcagcaggtggcggtggcggccagtgggaagccggagaccgagccgtcgggcagcagccagcagcgccggaggctccctgtgggggctgggctcctagagggctacatcagtgtcctggaccacaagcctttgaaaatgcactgcaagagttgtgcactggtaaccagttctggacaccttttgggaagcaaacaaggcaacagaatcgaccagactgagtgtgtaatacgaatgaacgatgcacccagtcgaggttatggaaaagatgttggaaacaaaactagccttcgagtcattgcacattctagtatccagagaattctgcgaaaccgcaatgaactgttaaatatgagtcaaggtactgtgtttatcttctggggtcccagcagctatatgagaagagatggaaaaggtttggtttataataatctgcaattgatgaatcagatactacctcaattaaaagtatatatggtttctcggcacaagatgcttcaatttgacgacctcttcaaacgggaaactggcaaagacaggaagatatccaacacttggcttagcacaggatggttcacaatgactatcgcattagaactctgtgacaggataaatgtttatggcatggtgccaccagatttctgcagattttcctctaggtgaaccaatctgtgcagttcctatttacctattccaaacaacccacaaactgtttcactgctcactctcgctgttaagaacatattgacttgctgcctgctctgttgtttaattcatttatgctgagagtcaggcatgaagacagaattttaaatgtgacatttgcaggctgttgggtcatctgaagctctgacaacaccagggaattcctgacatacaaactggtcctgatttccaatctccaatgttctgaacacatcagatattcttcccggaggtgcagatttcagccaaaaaaaccagaaaaaattaaaatcccttgtgttcacatcttgcagaaaaggcctgtacacttgaaagttttaaaataaagcccatgtttcctttaagctaaaactggcattgcctgcagcaagcaattcaactgcaaagaaacactctgattgacaaagatatttggaaagatctacaacaacaacaattaataaatactcataggatattctcagcaactttgacatttggtggatttccattttctcctgttgatctatcatggttcaaagtcaattgtgtctgaaggccagagctgtagataatctgccatctagacaatattaacatctggcccagtgggccagcagttaattacagccacaattagaatgaaatacctaaggcaaaactctaccaacagtgctttttgttgtgataccagctatgctgcacaaggaacagaaagtatgatggcactactgtagttggaaatggaaatgttactcagacctcattcagaattatattgggaagggaaattgttctccctgttcaactcttcattacaaatacactgtgataatggtattgtaatttagctgctttttcaaagacagcaggcatgttgtgattcgggtcaagatgcaagttggaagaaatctagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]