GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 08:35:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_032176304            1237 bp    mRNA    linear   PRI 26-JUL-2023
DEFINITION  PREDICTED: Hylobates moloch claudin 17 (CLDN17), mRNA.
ACCESSION   XM_032176304
VERSION     XM_032176304.2
DBLINK      BioProject: PRJNA600985
KEYWORDS    RefSeq.
SOURCE      Hylobates moloch (silvery gibbon)
  ORGANISM  Hylobates moloch
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hylobatidae; Hylobates.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026652289) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 26, 2023 this sequence version replaced XM_032176304.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_009828535.3-RS_2023_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/21/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1237
                     /organism="Hylobates moloch"
                     /mol_type="mRNA"
                     /isolate="HMO894"
                     /isolation_source="EBV transformed lymphoblastoid cell
                     line"
                     /db_xref="taxon:81572"
                     /chromosome="Unknown"
                     /sex="male"
                     /note="Lionel"
     gene            1..1237
                     /gene="CLDN17"
                     /note="claudin 17; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 mRNA, 2 Proteins"
                     /db_xref="GeneID:116482639"
     CDS             189..863
                     /gene="CLDN17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="XP_032032195.1"
                     /db_xref="GeneID:116482639"
                     /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHTGQKRELGAALFLGWASTAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYCVPHTDKRRNRTMLSKTSTSYV"
     misc_feature    204..734
                     /gene="CLDN17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
atgcatttacaacaggtacttctagttaggccaagttcagtcacagctactgatttggactaaaacgttatgggcagcagccaagaagaacatcatcaaagacttctctagactcaaaaggcttccacgttctacatcttgagcatcttctaccactccgaattgaatcagtcttcaaagtaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttccttgttggctctcccgcctgccctggaaacagcccgggccctcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacggccaatataatcatcagagatttttacaacccagccattcacacaggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcactgctgtcctcttcattggagggggtctgctttgtggattttgctgctgtaacagaaagaaacaagggtacagatatccagtgcctggctactgtgtgccacacacagataagcgaagaaacaggacaatgcttagtaagacctccaccagttatgtctaatgcccccttttggctccaagtatggactacggtcaatgttttttataaagtgctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaactgatatgaaagtttcaatttgttactggtggtaggaatggaaatgacttacttggacattctgacttcaggtgtattaaatgcattgactattgttggactcaattgctgttccaattttcatattctaaattcaagtatgcccataatcattggcaagtgtacaatgatggactactactttttgaccatcatatattatctgataagaatctaaagttgaaattgatattctataacaataaaacatatacctattctaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]