LOCUS       XM_031673373             316 bp    mRNA    linear   MAM 22-NOV-2019
DEFINITION  PREDICTED: Vicugna pacos phospholipid-transporting ATPase IK-like
            (LOC116278355), partial mRNA.
ACCESSION   XM_031673373
VERSION     XM_031673373.1
DBLINK      BioProject: PRJNA221631
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Vicugna pacos (alpaca)
  ORGANISM  Vicugna pacos
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Tylopoda;
            Camelidae; Vicugna.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_021997371.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Vicugna pacos Annotation Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 13% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..316
                     /organism="Vicugna pacos"
                     /mol_type="mRNA"
                     /isolate="Carlotta (AHFN-0088)"
                     /db_xref="taxon:30538"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
     gene            1..>316
                     /gene="LOC116278355"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 86% coverage of the annotated
                     genomic feature by RNAseq alignments, including 20 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:116278355"
     CDS             13..>316
                     /gene="LOC116278355"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase IK-like"
                     /protein_id="XP_031529233.1"
                     /db_xref="GeneID:116278355"
                     /translation="

MVPMAMFIMAEFIYLGNSIFINWDMHMYYEPQDMPAKARSTSLNDQLGQVEYVFSDKTGTLTQNVMAFRKCCISGVVYGEAPARHPFPTGAARPGPLQPAR"

     misc_feature    <13..>249
                     /gene="LOC116278355"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

ctgctcagcgtcatggtgcccatggccatgtttatcatggctgagttcatctacctggggaacagcatcttcatcaactgggacatgcatatgtactacgagccccaggacatgcccgccaaagcgcgaagcaccagcctcaatgaccagctgggccaggtggagtacgtcttctccgacaagactggcacgctcacccagaacgtcatggccttcaggaagtgctgcatcagtggcgttgtctacggtgaggccccagcccggcaccccttccccaccggggccgcccggcccggccccctccagcctgcccgcc

//