LOCUS       XM_031611835             344 bp    mRNA    linear   VRT 16-NOV-2019
DEFINITION  PREDICTED: Phasianus colchicus potassium-transporting ATPase alpha
            chain 1-like (LOC116241223), partial mRNA.
ACCESSION   XM_031611835
VERSION     XM_031611835.1
DBLINK      BioProject: PRJNA589599
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Phasianus colchicus (Ring-necked pheasant)
  ORGANISM  Phasianus colchicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Phasianus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022213059.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Phasianus colchicus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..344
                     /organism="Phasianus colchicus"
                     /mol_type="mRNA"
                     /isolate="SZU-A5-319"
                     /db_xref="taxon:9054"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
     gene            1..>344
                     /gene="LOC116241223"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 99% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:116241223"
     CDS             59..>344
                     /gene="LOC116241223"
                     /codon_start=1
                     /product="potassium-transporting ATPase alpha chain
                     1-like"
                     /protein_id="XP_031467695.1"
                     /db_xref="GeneID:116241223"
                     /translation="

MVFFMAIVVADVPEGLLATVTVCLSLTAKRLARKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVAHLWFDNQIHAADTTEDQSGTWGGGYG"

     misc_feature    <59..>325
                     /gene="LOC116241223"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

gtccctatggggtgcaggaggtccctatggggtcatcgggtcccccttcctccgggccatggtcttcttcatggccatcgtggtggccgacgtccccgaggggctgctggccaccgtcaccgtttgcctctccctgacggcgaagcgtctggcgaggaagaactgcgtggtgaagaacctggaggccgtggagaccttgggctccacgtcggtcatctgctccgacaaaaccgggaccctcacccaaaacaggatgactgtggcacatctgtggttcgacaaccagatccacgccgccgacaccaccgaggaccaatccggtacttgggggggcggttatgggg

//