LOCUS       XM_031545882             751 bp    mRNA    linear   PLN 06-NOV-2019
DEFINITION  PREDICTED: Punica granatum protein CLAVATA 3 (LOC116211479), mRNA.
ACCESSION   XM_031545882
VERSION     XM_031545882.1
DBLINK      BioProject: PRJNA580467
KEYWORDS    RefSeq.
SOURCE      Punica granatum (pomegranate)
  ORGANISM  Punica granatum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Myrtales; Lythraceae; Punica.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_045132.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Punica granatum Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..751
                     /organism="Punica granatum"
                     /mol_type="mRNA"
                     /isolate="Tunisia-2019"
                     /db_xref="taxon:22663"
                     /chromosome="6"
                     /tissue_type="leaf"
                     /dev_stage="mature fruiting plant"
                     /country="China: Zhengzhou"
     gene            1..751
                     /gene="LOC116211479"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 11 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:116211479"
     CDS             189..482
                     /gene="LOC116211479"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_031401742.1"
                     /db_xref="GeneID:116211479"
                     /translation="

MASSAALMAVCLLLLGASTLSAPLTTVSIRKVLVAVEDPPLVSNAIGAVPGGIEKSEGGGEMVESELRRVPSGPDPLHHHGSAPKKPDNRKSLPQTP"

ORIGIN      

ttcaaaaaatggctgctggaacaatcatttgggacagagcatcctcatctcttgtgcagatgatgatccgctcctgcttccatggcttccctataaatgccttgcctccagctctccctcttcttcacacctctcacctgtaccgtctctgttgataaggtgaagtcttcccataggaggttcataagatggcttcgtctgcagctttaatggccgtgtgcttgctgctcctgggagcctccactctgtcagctccgttgacgacagtgagcatcagaaaggtcttagtggctgtggaggatcctccattggtatcgaatgccattggagctgtcccgggagggattgagaagagcgaaggtggaggggagatggtagagtcagagctaagaagggttccttcaggtcctgatccgctgcaccatcacggttcggctcctaagaaacccgataaccgaaagagtctaccccagactccataagtgtccgtcccgagtcgttttttaacagttaggggaatgaaaactaaccttccttttggttctccccgaaaatgacgttagtcagtctcaccagctgaagtcagtcttgacgtttttgagttgcttctttttgggggtttgtcatatatatgtttgtctgctccctatatgtcagtcgtctatggctaatagcctaagagaagaattggaaccacataatatagtgcatggtaacaatacaatgtacaaaacgggcgcaatgcattttg

//