LOCUS       XM_031430850             659 bp    mRNA    linear   PLN 22-OCT-2019
DEFINITION  PREDICTED: Pistacia vera LOB domain-containing protein 1-like
            (LOC116145384), mRNA.
ACCESSION   XM_031430850
VERSION     XM_031430850.1
DBLINK      BioProject: PRJNA578116
KEYWORDS    RefSeq.
SOURCE      Pistacia vera
  ORGANISM  Pistacia vera
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae; Pistacia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022196292.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pistacia vera Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..659
                     /organism="Pistacia vera"
                     /mol_type="mRNA"
                     /cultivar="Batoury"
                     /db_xref="taxon:55513"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /country="China"
     gene            1..659
                     /gene="LOC116145384"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:116145384"
     CDS             122..640
                     /gene="LOC116145384"
                     /codon_start=1
                     /product="LOB domain-containing protein 1-like"
                     /protein_id="XP_031286710.1"
                     /db_xref="GeneID:116145384"
                     /translation="

MGSEKVSRTRTHQPCAACKMLRRRCDNNCILAPYFPIDEIENFACVHRVFGASNVIKMIQMAEETKREDAVKAIVYEATARLRDPVYGSAGTTFHLHKMVQDLKFELESIQSRVMALQEQRNQLLGIVMNVHHQDPVYPINDSMFDCGDFSLDDGSLAYDPVNFSMECDWIL"

     misc_feature    161..457
                     /gene="LOC116145384"
                     /note="Lateral organ boundaries (LOB) domain; Region: LOB;
                     pfam03195"
                     /db_xref="CDD:427193"
ORIGIN      

ttttgaatttaagtcccccataaacaagctatatacttacctgtttcttggcaacttcgcttttctttctgttatatatacttggattatttattccccaaaccaccatagtccttaaaaaatgggttctgaaaaggtgtcaagaaccaggactcatcaaccttgtgctgcttgtaagatgctacgtcggagatgtgacaacaattgcatacttgcaccatattttccaatcgatgagatagaaaactttgcctgtgtgcatagagtttttggagctagcaatgtcattaaaatgattcagatggctgaggagacgaagagggaggatgctgtcaaagcaatagtttatgaagcaacagcaaggctcagagaccctgtttatggcagtgctgggactacttttcacttgcataagatggttcaggatctgaaatttgagttggaatcaatacaaagtcgagttatggcgttgcaagaacaaagaaatcagttattgggtattgtcatgaatgttcatcaccaggatcctgtctaccccataaatgactccatgtttgattgtggggatttctcattagatgatggatctctagcctatgatcctgttaacttttctatggagtgtgactggattttgtaaggagattctgattctcccc

//