GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 05:09:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_031029252             709 bp    mRNA    linear   MAM 30-SEP-2019
DEFINITION  PREDICTED: Leptonychotes weddellii leucine zipper protein 6
            (LUZP6), mRNA.
ACCESSION   XM_031029252
VERSION     XM_031029252.1
DBLINK      BioProject: PRJNA232772
KEYWORDS    RefSeq; corrected model.
SOURCE      Leptonychotes weddellii (Weddell seal)
  ORGANISM  Leptonychotes weddellii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Pinnipedia; Phocidae; Leptonychotes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006383587.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Leptonychotes weddellii Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-176               APMU01063487.1     20221-20396         c
            177-709             APMU01063487.1     19687-20219         c
FEATURES             Location/Qualifiers
     source          1..709
                     /organism="Leptonychotes weddellii"
                     /mol_type="mRNA"
                     /isolate="WS11-02"
                     /db_xref="taxon:9713"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="liver"
     gene            1..709
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 mRNA, 5 ESTs, 1 Protein, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:115941284"
     CDS             15..311
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: leucine zipper protein 6"
                     /protein_id="XP_030885112.1"
                     /db_xref="GeneID:115941284"
                     /translation="
MFCSFCIKSVILYALYQVKTGGLPVYISILTNSAPLQLQTGICILRVQTQHPRIPSSSSRHSSPTPSGAQRRGGWVQCVQAASKALYSLISFPPDNGS"
ORIGIN      
agaaaaaatcttgcatgttctgtagtttttgtattaagtcagtcattttgtatgcactctatcaagtaaaaacaggcggtttacctgtttacattagtatcctaacaaattccgcccccttgcagcttcagactggcatctgtatacttagagttcaaacacagcacccaagaataccaagtagttcttctaggcatagctcacctacacccagcggggcacaaaggagaggtgggtgggtacagtgtgtgcaagctgcaagtaaggccctttactcattgatttctttcccccccgataatggatcttaaatctagatgtaccgacttttttttcctaaaacttcaacggagctgctctttacttccatgcaatattgtgtactcgattgtgtatagaagaagctggtgagagtgccctcctatataagcaattgcagtgttttgcatgcaaaattttaagaatttaaatcatcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccatcatgtaatacttttgacgcaattgggtttctcatatgatcctagttcatgtacatccgaatgctaaataataccgtgtttcagttttgtgttgcaagaacaaatggaataaacttgaattgtgctacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]