2024-05-20 05:09:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_031029252 709 bp mRNA linear MAM 30-SEP-2019 DEFINITION PREDICTED: Leptonychotes weddellii leucine zipper protein 6 (LUZP6), mRNA. ACCESSION XM_031029252 VERSION XM_031029252.1 DBLINK BioProject: PRJNA232772 KEYWORDS RefSeq; corrected model. SOURCE Leptonychotes weddellii (Weddell seal) ORGANISM Leptonychotes weddellii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Pinnipedia; Phocidae; Leptonychotes. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006383587.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Leptonychotes weddellii Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-176 APMU01063487.1 20221-20396 c 177-709 APMU01063487.1 19687-20219 c FEATURES Location/Qualifiers source 1..709 /organism="Leptonychotes weddellii" /mol_type="mRNA" /isolate="WS11-02" /db_xref="taxon:9713" /chromosome="Unknown" /sex="female" /tissue_type="liver" gene 1..709 /gene="LUZP6" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 5 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:115941284" CDS 15..311 /gene="LUZP6" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: leucine zipper protein 6" /protein_id="XP_030885112.1" /db_xref="GeneID:115941284" /translation="
MFCSFCIKSVILYALYQVKTGGLPVYISILTNSAPLQLQTGICILRVQTQHPRIPSSSSRHSSPTPSGAQRRGGWVQCVQAASKALYSLISFPPDNGS"
ORIGIN
agaaaaaatcttgcatgttctgtagtttttgtattaagtcagtcattttgtatgcactctatcaagtaaaaacaggcggtttacctgtttacattagtatcctaacaaattccgcccccttgcagcttcagactggcatctgtatacttagagttcaaacacagcacccaagaataccaagtagttcttctaggcatagctcacctacacccagcggggcacaaaggagaggtgggtgggtacagtgtgtgcaagctgcaagtaaggccctttactcattgatttctttcccccccgataatggatcttaaatctagatgtaccgacttttttttcctaaaacttcaacggagctgctctttacttccatgcaatattgtgtactcgattgtgtatagaagaagctggtgagagtgccctcctatataagcaattgcagtgttttgcatgcaaaattttaagaatttaaatcatcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccatcatgtaatacttttgacgcaattgggtttctcatatgatcctagttcatgtacatccgaatgctaaataataccgtgtttcagttttgtgttgcaagaacaaatggaataaacttgaattgtgctacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]