LOCUS       XM_029726743             493 bp    mRNA    linear   VRT 01-JUL-2019
DEFINITION  PREDICTED: Salmo trutta RNA binding protein fox-1 homolog 1-like
            (LOC115170528), mRNA.
ACCESSION   XM_029726743
VERSION     XM_029726743.1
DBLINK      BioProject: PRJNA550988
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Salmo trutta (river trout)
  ORGANISM  Salmo trutta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042988.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Salmo trutta Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 7% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..493
                     /organism="Salmo trutta"
                     /mol_type="mRNA"
                     /db_xref="taxon:8032"
                     /chromosome="32"
     gene            1..493
                     /gene="LOC115170528"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 94% coverage of the annotated
                     genomic feature by RNAseq alignments, including 10 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:115170528"
     CDS             179..493
                     /gene="LOC115170528"
                     /codon_start=1
                     /product="RNA binding protein fox-1 homolog 1-like"
                     /protein_id="XP_029582603.1"
                     /db_xref="GeneID:115170528"
                     /translation="

MEEKEEGKMVEQGNQEAPPPPDSMTQPYPSAQFAPPQNGLPAEFTASHPHPAPPDYTGQPPVSEHPLNMYPTSQNHSEQSGQDTSIQPVSATATVRHLYFITTS"

ORIGIN      

cactcacacacacacacatacactgaacacacacacacgcacacactgaacacacccacacacggggaacccacgccccatccataattgatgctagctgtgggcaggcagatgctggaggcaggaggaagaagggaggaagaagggagggaaggagggaaagcagctggatgtgtttatggaggagaaagaggaaggcaagatggtggagcagggtaaccaggaagcccctccccctccagactccatgactcagccgtacccctccgcccaatttgccccccctcagaacggcttgcccgctgagttcaccgcctctcaccctcaccctgcgccccccgactacacaggacagccccccgtcagtgaacaccccctcaacatgtaccccacttcacagaaccacagtgaacagagtggacaggacaccagcatacagcccgtctcagccacagccacagtaagacatctctactttattacaacatcttga

//