LOCUS       XM_029648528             926 bp    mRNA    linear   VRT 01-JUL-2019
DEFINITION  PREDICTED: Oncorhynchus nerka copper-transporting ATPase 2-like
            (LOC115119668), partial mRNA.
ACCESSION   XM_029648528
VERSION     XM_029648528.1
DBLINK      BioProject: PRJNA548514
KEYWORDS    RefSeq.
SOURCE      Oncorhynchus nerka (sockeye salmon)
  ORGANISM  Oncorhynchus nerka
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_021793892.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Oncorhynchus nerka Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..926
                     /organism="Oncorhynchus nerka"
                     /mol_type="mRNA"
                     /isolate="On170113-E2"
                     /db_xref="taxon:8023"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="Caudal fin"
                     /dev_stage="fry"
                     /country="Canada: Pitt Lake, BC"
                     /genotype="Doubled Haploid"
     gene            1..>926
                     /gene="LOC115119668"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 53 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:115119668"
     CDS             132..>926
                     /gene="LOC115119668"
                     /codon_start=1
                     /product="copper-transporting ATPase 2-like"
                     /protein_id="XP_029504388.1"
                     /db_xref="GeneID:115119668"
                     /translation="

MAHSSFGSTNTSINGSSGSTKTSINGSSGSTKMATAGEEGKVQKCFIRVTGMTCASCVANIERNLVKHRGVISVLVALMAGKAEVKYDPGIVDAKRITQLIEGLGFGATLIEDNAVMDGKLDLSVTGMTCASCVHNIESKLTRTKGILEASVALATNKAQIKFDPEVLGARDIIRMIEGLGFGASLMKAEGFGNNLDHGEEIQQWKNSFLFSLVFGVPVMGLMIYMMVMDSQHGEHGGSMPEEQNLLPGLSLLNLAFFLLCTPVQ"

     misc_feature    270..458
                     /gene="LOC115119668"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(285..293,300..302)
                     /gene="LOC115119668"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    495..686
                     /gene="LOC115119668"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(513..521,528..530)
                     /gene="LOC115119668"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    750..>926
                     /gene="LOC115119668"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

tagtgttccctttatttgtttgagcagtgtatgttgtgttcttttctcctgaataatctggttctgcagaaactccaacaacccctccccttcaaagacaaaagactcccctttccccccactcccccagaatggctcacagtagctttggctctaccaatacttccattaatggtagctctggctctaccaagacttccattaacggtagctctggctctaccaagatggccactgctggtgaggaggggaaggttcagaagtgcttcatccgtgtgacaggcatgacctgtgcgtcctgtgtggccaacattgagaggaacttagtcaaacacagaggtgtcatctcagtgctggttgccctcatggctggtaaggcggaggtgaagtatgaccctggtattgttgatgccaagcggataacacagctcatagagggtctaggcttcggtgccacactgatagaggacaatgctgttatggatgggaaactggacctctctgtaactgggatgacatgtgcgtcatgtgtccataacattgagtccaaactcaccaggaccaaagggattctagaagcctcagttgcactggcaaccaataaagcccagataaagtttgacccagaagtgcttggagctcgtgacatcatcagaatgattgaggggctgggctttggggcgtctctaatgaaagctgaaggctttgggaacaacctggatcatggggaagagattcaacagtggaagaactcgttcctgttcagtctggtgtttggggtgccagtgatgggcttgatgatctacatgatggtgatggacagtcagcacggggaacacggtggctctatgcctgaggagcagaaccttctcccaggcctctccctcctcaacctggccttcttcctgctctgtacacctgtccag

//