LOCUS       XM_029110494             570 bp    mRNA    linear   INV 07-MAY-2019
DEFINITION  PREDICTED: Metaseiulus occidentalis copper-transporting ATPase
            2-like (LOC114827997), mRNA.
ACCESSION   XM_029110494
VERSION     XM_029110494.1
DBLINK      BioProject: PRJNA166945
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Galendromus occidentalis (western predatory mite)
  ORGANISM  Galendromus occidentalis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida;
            Acari; Parasitiformes; Mesostigmata; Gamasina; Phytoseioidea;
            Phytoseiidae; Typhlodrominae; Galendromus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003804581.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Galendromus occidentalis Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..570
                     /organism="Galendromus occidentalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:34638"
                     /chromosome="Unknown"
     gene            1..570
                     /gene="LOC114827997"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 long SRA reads, 1 Protein"
                     /db_xref="GeneID:114827997"
     CDS             1..570
                     /gene="LOC114827997"
                     /codon_start=1
                     /product="copper-transporting ATPase 2-like"
                     /protein_id="XP_028966327.1"
                     /db_xref="GeneID:114827997"
                     /translation="

MEPTVEHTLSVLGMTCKSCVNSIQLTIGERSDVKSVKVALDEAKAYVSAPASVSPAVLAAAIDDMGFEAAYLHTTTSIRIDGMTCQSCVLNIQNTLTPVEGIIEIEISLEEAKGTFKFDAKSISVQQIVEHIDDMGFIPKWPYEEDVDKDFDQIAKRHASALDEVDAILSGSDPDGWVTNSEDTIRETL"

     misc_feature    22..210
                     /gene="LOC114827997"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(40..48,55..57)
                     /gene="LOC114827997"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    232..411
                     /gene="LOC114827997"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(247..255,262..264)
                     /gene="LOC114827997"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
ORIGIN      

atggaaccgacggtagagcacacgctgtccgtcttgggcatgacctgcaaatcatgcgtcaacagcattcaactcaccatcggagagagatcagatgtcaaaagcgtcaaggtcgccctggatgaggcgaaagcttacgtgtctgctccggcgtcagtgtcccctgcggttctagctgcagcgatagacgacatgggcttcgaagccgcttacctgcacacgacgacaagcatccgaatcgatggtatgacatgccaatcgtgcgtgctaaatatccagaacacgttgacaccggtcgaagggatcatcgaaatcgaaatatccctcgaagaagcgaaaggaaccttcaaattcgatgccaaaagcatatccgtacaacagatcgtcgaacatatcgacgatatgggattcattccgaaatggccgtacgaagaagacgtggacaaggactttgatcagattgccaagcgacacgcttcagctctggatgaggtcgacgcgatcctgagcggctccgacccggacggctgggtcacaaactcagaggataccatcagagaaacactgtga

//