2024-05-19 10:06:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_028645638 237 bp mRNA linear PLN 05-APR-2019 DEFINITION Alternaria arborescens hypothetical protein (AA0111_g11739), partial mRNA. ACCESSION XM_028645638 VERSION XM_028645638.1 DBLINK BioProject: PRJNA531023 BioSample: SAMN06205217 KEYWORDS RefSeq. SOURCE Alternaria arborescens ORGANISM Alternaria arborescens Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae; Pleosporaceae; Alternaria; Alternaria sect. Alternaria. REFERENCE 1 (bases 1 to 237) AUTHORS Armitage,A.D., Cockerton,H.M., Sreenivasaprasad,S., Woodhall,J., Lane,C., Harrison,R.J. and Clarkson,J.P. TITLE Genomics, evolutionary history and diagnostics of the Alternaria alternata species group including apple and Asian pear pathotypes JOURNAL bioRxivorg (2019) In press REFERENCE 2 (bases 1 to 237) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (05-APR-2019) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 237) AUTHORS Armitage,A.D., Barbara,D.J., Woodhall,J.W., Sreenivasaprasad,S., Lane,C.R., Clarkson,J.P. and Harrison,R.J. TITLE Direct Submission JOURNAL Submitted (18-OCT-2017) Genetics, Genomics and Breeding, NIAB-East Malling Research, New Road, East Malling, Kent ME19 6BJ, United Kingdom COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_021167911). ##Genome-Annotation-Data-START## Annotation Date :: AUG-2017 Annotation Method :: Ab initio gene prediction: Braker 1.9 and CodingQuary 2.0; Functional annotation: Swissprot (July 2016 release) and Interproscan 5.18-57.0 Annotation Provider :: Harrison Lab NIAB-EMR Annotation Version :: Release 1.01 ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..237 /organism="Alternaria arborescens" /mol_type="mRNA" /strain="FERA 675" /isolation_source="infected leaves" /host="apple" /db_xref="taxon:156630" /chromosome="Unknown" gene <1..>237 /locus_tag="AA0111_g11739" /db_xref="GeneID:39615252" CDS 1..237 /locus_tag="AA0111_g11739" /codon_start=1 /product="hypothetical protein" /protein_id="XP_028500696.1" /db_xref="GeneID:39615252" /translation="
MSSPAQPSPEVLQAYYQRLETLYSSLPDLLTTEQEDKTGTEALEQDVGKLDVKEPNLQDRVNKYCQEFLYIGGPTPHK"
misc_feature <19..>204 /locus_tag="AA0111_g11739" /note="chromosome partition protein MukB; Region: mukB; PRK04863" /db_xref="CDD:235316" ORIGIN
atgtcgtctccagcccaaccttctcctgaagtcctacaagcctactaccaaagactagaaaccctttactcaagtctaccggaccttctcaccaccgagcaggaagacaagaccggaaccgaagcactcgaacaagacgttggtaagcttgacgtcaaggaaccgaacctacaagacagggtcaacaagtactgtcaagagtttctttacatcggcggccctacaccccataaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]