GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 11:22:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_028550037            1715 bp    mRNA    linear   INV 29-MAR-2019
DEFINITION  PREDICTED: Dendronephthya gigantea copper chaperone for superoxide
            dismutase-like (LOC114528414), mRNA.
ACCESSION   XM_028550037
VERSION     XM_028550037.1
DBLINK      BioProject: PRJNA529494
KEYWORDS    RefSeq.
SOURCE      Dendronephthya gigantea
  ORGANISM  Dendronephthya gigantea
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Octocorallia;
            Malacalcyonacea; Nephtheidae; Dendronephthya.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_021163060.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Dendronephthya gigantea Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1715
                     /organism="Dendronephthya gigantea"
                     /mol_type="mRNA"
                     /isolate="DGI-Jeju-01"
                     /isolation_source="individual from underwater near
                     Seogwipo"
                     /db_xref="taxon:151771"
                     /chromosome="Unknown"
                     /tissue_type="Adult whole colony"
                     /country="South Korea: Jeju Island"
                     /collection_date="22-May-2015"
     gene            1..1715
                     /gene="LOC114528414"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 2 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:114528414"
     CDS             728..1531
                     /gene="LOC114528414"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase-like"
                     /protein_id="XP_028405838.1"
                     /db_xref="GeneID:114528414"
                     /translation="
MAGSEGNSLTKMEFAVQMTCQSCVLSIQAALESAKGVESFNINLHDEQVTVETNLPSGLIQQILEQTGRKAILRGHGATQDRSTFHIGAAVAIMSGENNIQGVIRFVQVDNKRCIIDGTIDELQPGAHGLHIHELGDISNGCESLGDHYNPNNCEHGGMFDEEKHIGDLGNIIADKKKRAQFRLESYDVKVWDVIGRSIVVSEHEDDLGRENNPQSKIDGNSGLRLACGIIARSAGLFQNTKKFCACTGMTLWEERDLKKEHPLSQL"
     misc_feature    764..1489
                     /gene="LOC114528414"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      
gacaaaaaagtgtttaataactatttaaatatttgaaacattgtttgaataatatctgcgttctttttatgcagagtattcagagatatacacacctggttttcttttcttgcaacgaagagcgaatttcctttccaccgcatcgtccacatggtcttgaaaactgactgtcgagtgtcgatcactcaatctgccaaaaactgtcacatgaccgaaactgcagcttgtgattggctaatttggtcacaccacattgcccacaatgcaatagaccactgacctgtatttattatgaccagtgaattcgattcttctggactatatcctatttttgagtgggataatgtttcatatttttatttcactgtttggtagtgtttgcaacctaaaacagaacaaatttaagcaaattcttgataaacctcgcaataattggtgctcaggcggatctgaaatagcctcactgcccgcagaacaggctcctccaggaattattatatagctcagtggccccctacccacatttataggtcagtggggcccaatgaccttaatatacactggacagctggataatttgtgtgaaaaataatataaatctacaaccttattaaacatactatttctgattggtccattcttctcagttaatttgcaattagtactgctaatatgcagtaactatcagtaactatagaggagactttactaacttcaaacaaggaaaatggctgggtcagaaggcaacagtttaactaagatggagtttgctgttcagatgacttgccaaagttgtgtcttgagcattcaggcagcactagagtcagcaaaaggagttgaatctttcaacattaatttacatgatgaacaagtaacagtagaaacaaacttgccttctggtttgatacaacagatccttgagcagacaggaagaaaagcgatattgcgtggccatggtgcaacacaagataggagtacattccatattggagccgctgttgcaattatgtccggtgaaaataacattcaaggtgtaatacggtttgttcaagttgataacaaaagatgtataattgatggtactatagatgaactacaaccaggtgcacatggactacacatacatgagctgggtgatatttctaatggctgtgaaagtttaggggatcattacaatccaaacaactgcgaacatggaggaatgtttgatgaagaaaagcatattggtgatttgggaaacataattgcagataaaaaaaagcgtgcacagtttcgtttggaaagttatgatgttaaggtgtgggatgtaattggtcgatcaattgttgtgagtgaacatgaagatgatttaggaagggaaaacaatccacaatcaaaaattgatggcaactctggactcagacttgcatgtggtattattgcaaggtcagctggattatttcaaaacacgaaaaagttctgcgcatgtactgggatgactttgtgggaagaacgagacttgaaaaaagagcacccactttctcaactctaatgtgattgaatatgctaaatagatcagacaattttattatcctgttgtgtcccagtctaacctcatttgcactgtaaaagctggactgatttcaaatcagaaaatatatacctgtccccagtggcgtagccagcccgacaatttagtcaagctatgctaatattttggtgttcatcgactgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]