2024-05-19 11:22:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_028550037 1715 bp mRNA linear INV 29-MAR-2019 DEFINITION PREDICTED: Dendronephthya gigantea copper chaperone for superoxide dismutase-like (LOC114528414), mRNA. ACCESSION XM_028550037 VERSION XM_028550037.1 DBLINK BioProject: PRJNA529494 KEYWORDS RefSeq. SOURCE Dendronephthya gigantea ORGANISM Dendronephthya gigantea Eukaryota; Metazoa; Cnidaria; Anthozoa; Octocorallia; Malacalcyonacea; Nephtheidae; Dendronephthya. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_021163060.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Dendronephthya gigantea Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1715 /organism="Dendronephthya gigantea" /mol_type="mRNA" /isolate="DGI-Jeju-01" /isolation_source="individual from underwater near Seogwipo" /db_xref="taxon:151771" /chromosome="Unknown" /tissue_type="Adult whole colony" /country="South Korea: Jeju Island" /collection_date="22-May-2015" gene 1..1715 /gene="LOC114528414" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:114528414" CDS 728..1531 /gene="LOC114528414" /codon_start=1 /product="copper chaperone for superoxide dismutase-like" /protein_id="XP_028405838.1" /db_xref="GeneID:114528414" /translation="
MAGSEGNSLTKMEFAVQMTCQSCVLSIQAALESAKGVESFNINLHDEQVTVETNLPSGLIQQILEQTGRKAILRGHGATQDRSTFHIGAAVAIMSGENNIQGVIRFVQVDNKRCIIDGTIDELQPGAHGLHIHELGDISNGCESLGDHYNPNNCEHGGMFDEEKHIGDLGNIIADKKKRAQFRLESYDVKVWDVIGRSIVVSEHEDDLGRENNPQSKIDGNSGLRLACGIIARSAGLFQNTKKFCACTGMTLWEERDLKKEHPLSQL"
misc_feature 764..1489 /gene="LOC114528414" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" ORIGIN
gacaaaaaagtgtttaataactatttaaatatttgaaacattgtttgaataatatctgcgttctttttatgcagagtattcagagatatacacacctggttttcttttcttgcaacgaagagcgaatttcctttccaccgcatcgtccacatggtcttgaaaactgactgtcgagtgtcgatcactcaatctgccaaaaactgtcacatgaccgaaactgcagcttgtgattggctaatttggtcacaccacattgcccacaatgcaatagaccactgacctgtatttattatgaccagtgaattcgattcttctggactatatcctatttttgagtgggataatgtttcatatttttatttcactgtttggtagtgtttgcaacctaaaacagaacaaatttaagcaaattcttgataaacctcgcaataattggtgctcaggcggatctgaaatagcctcactgcccgcagaacaggctcctccaggaattattatatagctcagtggccccctacccacatttataggtcagtggggcccaatgaccttaatatacactggacagctggataatttgtgtgaaaaataatataaatctacaaccttattaaacatactatttctgattggtccattcttctcagttaatttgcaattagtactgctaatatgcagtaactatcagtaactatagaggagactttactaacttcaaacaaggaaaatggctgggtcagaaggcaacagtttaactaagatggagtttgctgttcagatgacttgccaaagttgtgtcttgagcattcaggcagcactagagtcagcaaaaggagttgaatctttcaacattaatttacatgatgaacaagtaacagtagaaacaaacttgccttctggtttgatacaacagatccttgagcagacaggaagaaaagcgatattgcgtggccatggtgcaacacaagataggagtacattccatattggagccgctgttgcaattatgtccggtgaaaataacattcaaggtgtaatacggtttgttcaagttgataacaaaagatgtataattgatggtactatagatgaactacaaccaggtgcacatggactacacatacatgagctgggtgatatttctaatggctgtgaaagtttaggggatcattacaatccaaacaactgcgaacatggaggaatgtttgatgaagaaaagcatattggtgatttgggaaacataattgcagataaaaaaaagcgtgcacagtttcgtttggaaagttatgatgttaaggtgtgggatgtaattggtcgatcaattgttgtgagtgaacatgaagatgatttaggaagggaaaacaatccacaatcaaaaattgatggcaactctggactcagacttgcatgtggtattattgcaaggtcagctggattatttcaaaacacgaaaaagttctgcgcatgtactgggatgactttgtgggaagaacgagacttgaaaaaagagcacccactttctcaactctaatgtgattgaatatgctaaatagatcagacaattttattatcctgttgtgtcccagtctaacctcatttgcactgtaaaagctggactgatttcaaatcagaaaatatatacctgtccccagtggcgtagccagcccgacaatttagtcaagctatgctaatattttggtgttcatcgactgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]