LOCUS       XM_028353629             897 bp    mRNA    linear   PLN 12-MAR-2019
DEFINITION  PREDICTED: Glycine soja ER membrane protein complex subunit 6-like
            (LOC114392481), transcript variant X1, mRNA.
ACCESSION   XM_028353629
VERSION     XM_028353629.1
DBLINK      BioProject: PRJNA525136
KEYWORDS    RefSeq.
SOURCE      Glycine soja
  ORGANISM  Glycine soja
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041018.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Glycine soja Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..897
                     /organism="Glycine soja"
                     /mol_type="mRNA"
                     /cultivar="W05"
                     /db_xref="taxon:3848"
                     /chromosome="17"
                     /tissue_type="hypocotyl of etiolated seedlings"
                     /dev_stage="Seedlings"
                     /country="China: Henan"
     gene            1..897
                     /gene="LOC114392481"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 24 ESTs, 9 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 202 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:114392481"
     CDS             149..511
                     /gene="LOC114392481"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 6-like"
                     /protein_id="XP_028209430.1"
                     /db_xref="GeneID:114392481"
                     /translation="

MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTFAFDIVHIF"

     misc_feature    251..481
                     /gene="LOC114392481"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:429250"
ORIGIN      

cacgaatcacaaatcgtaacattggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagttacatattattcgagtagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctctttttgtggctgtcaa

//