LOCUS       XM_028222835             483 bp    mRNA    linear   PLN 05-MAR-2019
DEFINITION  PREDICTED: Camellia sinensis calcium-transporting ATPase 2,
            endoplasmic reticulum-type-like (LOC114280458), mRNA.
ACCESSION   XM_028222835
VERSION     XM_028222835.1
DBLINK      BioProject: PRJNA524157
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Camellia sinensis
  ORGANISM  Camellia sinensis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; Ericales; Theaceae; Camellia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_021026640.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Camellia sinensis Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..483
                     /organism="Camellia sinensis"
                     /mol_type="mRNA"
                     /cultivar="Shuchazao"
                     /db_xref="taxon:4442"
                     /chromosome="Unknown"
                     /tissue_type="young leaf"
                     /country="China: Anhui"
     gene            1..483
                     /gene="LOC114280458"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:114280458"
     CDS             1..483
                     /gene="LOC114280458"
                     /codon_start=1
                     /product="calcium-transporting ATPase 2, endoplasmic
                     reticulum-type-like"
                     /protein_id="XP_028078636.1"
                     /db_xref="GeneID:114280458"
                     /translation="

MGLPSTDHSVDAVLREQLVPSPPINGRLFCRGAGIKVTVITGDNKLTAEAICKVFSRAEPRHKQEIVRMLKETGEIVAMTGDGVNDAPALKLADIGIAMRITGTEAAKEGSDMVLADDSFNPIVSAVAEGCSIYNNTKAFIRYMISSNVGEVISIFLTAA"

     misc_feature    <88..>480
                     /gene="LOC114280458"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
     misc_feature    121..123
                     /gene="LOC114280458"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319763"
ORIGIN      

atgggcctgccatctaccgaccacagcgttgacgctgtgctacgtgaacaacttgtaccctctcccccaatcaatggaagattgttttgtagaggagctgggattaaagtcacggtgataactggcgataataagttgactgcagaggctatttgtaaagtgttctcacgtgcggagcctaggcacaagcaagaaattgtaaggatgctaaaggagacgggagaaattgttgcaatgactggtgatggtgtgaatgatgcacctgcactgaaacttgctgatattggaattgccatgcggatcactggcacagaggctgcaaaagaaggttcagatatggttttggcagatgatagttttaaccccattgtctctgctgtggcagagggttgctctatttataataacacgaaagcttttatcaggtacatgatatcgtctaatgttggggaggttatatccatattcttgactgctgcttaa

//