LOCUS       XM_027917980             543 bp    mRNA    linear   PLN 28-JAN-2019
DEFINITION  PREDICTED: Solanum pennellii transcription factor VIP1-like
            (LOC114077646), mRNA.
ACCESSION   XM_027917980
VERSION     XM_027917980.1
DBLINK      BioProject: PRJNA256426
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Solanum pennellii
  ORGANISM  Solanum pennellii
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum; Solanum subgen. Lycopersicon.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_028642.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Solanum pennellii Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..543
                     /organism="Solanum pennellii"
                     /mol_type="mRNA"
                     /db_xref="taxon:28526"
                     /chromosome="6"
                     /note="Tomato Genetics Resource Center (TGRC):accession
                     LA0716"
     gene            1..543
                     /gene="LOC114077646"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins"
                     /db_xref="GeneID:114077646"
     CDS             1..543
                     /gene="LOC114077646"
                     /codon_start=1
                     /product="transcription factor VIP1-like"
                     /protein_id="XP_027773781.1"
                     /db_xref="GeneID:114077646"
                     /translation="

MDEKRKRSYESDLDLCSKTPTQNELINNVQTLEEAMNSELKHGQVDPNVDWKKMKRIMSNRLSAQRSRNKKIEYTAELEKKVKELEHTIAWAGSEIENAKDNKKKLMLENEMLQEQMDIVTHKSNSSIAQTEELKVELKRLKELAKSQKIEGQSSNFCESEVDMDQYLNFDTMNFYPHQD"

     misc_feature    157..291
                     /gene="LOC114077646"
                     /note="Basic leucine zipper (bZIP) domain of Plant
                     RF2-like transcription factors: a DNA-binding and
                     dimerization domain; Region: bZIP_plant_RF2; cd14703"
                     /db_xref="CDD:269851"
     misc_feature    157..291
                     /gene="LOC114077646"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269851"
     misc_feature    order(166..171,175..183,187..204,208..216)
                     /gene="LOC114077646"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269851"
ORIGIN      

atggatgagaaacgaaaaagatcttatgagtctgatttggatttgtgctcgaaaactccaactcaaaatgaactaattaataatgttcaaacattggaagaagcaatgaattctgaactcaagcatggtcaagtagatcctaacgtagattggaagaaaatgaaaagaatcatgtcaaatcgactatcagcacaaagatccaggaacaaaaagatagaatacacagctgaattggaaaagaaagtcaaagaattagagcatacaatagcttgggcgggatcagaaatagaaaatgctaaagataataaaaagaagttgatgctggagaacgaaatgttgcaagaacaaatggatattgtcactcacaaatctaattcaagcattgcacaaactgaagagttgaaagttgagttgaaaaggcttaaggaacttgcaaagagtcaaaagattgaaggacaaagttccaacttttgtgagtcagaagtagacatggatcagtatctcaactttgataccatgaacttttacccacaccaggattga

//