2024-05-19 07:42:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_027838685 792 bp mRNA linear MAM 24-JAN-2019 DEFINITION PREDICTED: Vombatus ursinus keratin-associated protein 16-1-like (LOC114025297), mRNA. ACCESSION XM_027838685 VERSION XM_027838685.1 DBLINK BioProject: PRJNA492302 KEYWORDS RefSeq; includes ab initio. SOURCE Vombatus ursinus (common wombat) ORGANISM Vombatus ursinus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Vombatidae; Vombatus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020944374.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Vombatus ursinus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..792 /organism="Vombatus ursinus" /mol_type="mRNA" /db_xref="taxon:29139" /chromosome="Unknown" gene 1..792 /gene="LOC114025297" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:114025297" CDS 1..792 /gene="LOC114025297" /codon_start=1 /product="keratin-associated protein 16-1-like" /protein_id="XP_027694486.1" /db_xref="GeneID:114025297" /translation="
MSVRLPVCPCLLVCPCPSVCPCPSVCPCLCVPVCPSVHLSVCPSVRLCVRVRRCVPVSVCPCLCLCPCPSVCPCVCLCVPVYVSLSVCSCLCPCVRVRPSVPVSVRVSVRPCVCVCPCVSVSVRVSLSVCPCVSVSVRVSLSVCPCVSVCPCPSVRVSPCLSVCPCPSVRVSLSVCVSVRVSLCLPVCPCLCVRLSVSLSLFVRVCLSVSVRVSVSVRVSVSVRVSLSLSFSGQALEVQSFAVLVLWVCARPPPPPAFVTVGL"
ORIGIN
atgtctgtccgtctgcctgtgtgtccgtgtctgctcgtgtgtccgtgtccgtcggtgtgtccctgtccatctgtgtgtccctgtctgtgtgtccctgtctgtccgtctgtccatctgtccgtctgtccatctgtccgtctgtgtgtccgtgtccgtcggtgtgtccctgtgtctgtgtgtccgtgtctctgtctgtgtccctgtccgtctgtgtgtccctgtgtatgtctgtgtgtccctgtttatgtgtccctgtctgtgtgttcctgtctctgtccgtgtgtccgtgtccgtccgtccgtccctgtgtctgtccgtgtgtccgtccgtccgtgtgtctgtgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccgtctgtccgtgtgtgtccgtgtgtccctgtccgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccatctgtccgtgtgtccctgtccgtctgtgtgtctgtccgtgtgtctctgtgtctgcctgtgtgtccctgtctgtgtgtccgtctgtctgtgtccctgtctctgtttgtccgtgtctgtctgtccgtgtctgtccgtgtgtccgtgtctgtccgtgtgtccgtgtctgtccgtgtgtccctgtctctgtctttctctggccaggcactggaagttcagagctttgcagtgctggtgctatgggtttgtgcccgacccccccctcccccagcttttgtgaccgtaggcctgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]