GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 07:42:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_027838685             792 bp    mRNA    linear   MAM 24-JAN-2019
DEFINITION  PREDICTED: Vombatus ursinus keratin-associated protein 16-1-like
            (LOC114025297), mRNA.
ACCESSION   XM_027838685
VERSION     XM_027838685.1
DBLINK      BioProject: PRJNA492302
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Vombatus ursinus (common wombat)
  ORGANISM  Vombatus ursinus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Metatheria; Diprotodontia; Vombatidae; Vombatus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020944374.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Vombatus ursinus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..792
                     /organism="Vombatus ursinus"
                     /mol_type="mRNA"
                     /db_xref="taxon:29139"
                     /chromosome="Unknown"
     gene            1..792
                     /gene="LOC114025297"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:114025297"
     CDS             1..792
                     /gene="LOC114025297"
                     /codon_start=1
                     /product="keratin-associated protein 16-1-like"
                     /protein_id="XP_027694486.1"
                     /db_xref="GeneID:114025297"
                     /translation="
MSVRLPVCPCLLVCPCPSVCPCPSVCPCLCVPVCPSVHLSVCPSVRLCVRVRRCVPVSVCPCLCLCPCPSVCPCVCLCVPVYVSLSVCSCLCPCVRVRPSVPVSVRVSVRPCVCVCPCVSVSVRVSLSVCPCVSVSVRVSLSVCPCVSVCPCPSVRVSPCLSVCPCPSVRVSLSVCVSVRVSLCLPVCPCLCVRLSVSLSLFVRVCLSVSVRVSVSVRVSVSVRVSLSLSFSGQALEVQSFAVLVLWVCARPPPPPAFVTVGL"
ORIGIN      
atgtctgtccgtctgcctgtgtgtccgtgtctgctcgtgtgtccgtgtccgtcggtgtgtccctgtccatctgtgtgtccctgtctgtgtgtccctgtctgtccgtctgtccatctgtccgtctgtccatctgtccgtctgtgtgtccgtgtccgtcggtgtgtccctgtgtctgtgtgtccgtgtctctgtctgtgtccctgtccgtctgtgtgtccctgtgtatgtctgtgtgtccctgtttatgtgtccctgtctgtgtgttcctgtctctgtccgtgtgtccgtgtccgtccgtccgtccctgtgtctgtccgtgtgtccgtccgtccgtgtgtctgtgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccgtctgtccgtgtgtgtccgtgtgtccctgtccgtctgtccgtgtgtctccgtgtctgtccgtgtgtccctgtccatctgtccgtgtgtccctgtccgtctgtgtgtctgtccgtgtgtctctgtgtctgcctgtgtgtccctgtctgtgtgtccgtctgtctgtgtccctgtctctgtttgtccgtgtctgtctgtccgtgtctgtccgtgtgtccgtgtctgtccgtgtgtccgtgtctgtccgtgtgtccctgtctctgtctttctctggccaggcactggaagttcagagctttgcagtgctggtgctatgggtttgtgcccgacccccccctcccccagcttttgtgaccgtaggcctgtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]