LOCUS       XM_027581087             945 bp    mRNA    linear   MAM 06-AUG-2020
DEFINITION  PREDICTED: Zalophus californianus copper chaperone for superoxide
            dismutase (CCS), transcript variant X4, mRNA.
ACCESSION   XM_027581087
VERSION     XM_027581087.2
DBLINK      BioProject: PRJNA602522
KEYWORDS    RefSeq.
SOURCE      Zalophus californianus (California sea lion)
  ORGANISM  Zalophus californianus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Pinnipedia; Otariidae; Zalophus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_045605.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 6, 2020 this sequence version replaced XM_027581087.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Zalophus californianus Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..945
                     /organism="Zalophus californianus"
                     /mol_type="mRNA"
                     /isolate="mZalCal1"
                     /db_xref="taxon:9704"
                     /chromosome="11"
                     /sex="male"
                     /tissue_type="blood"
                     /country="USA: California"
                     /lat_lon="37.858768 N 122.484010 W"
                     /collection_date="07-Jul-2018"
                     /collected_by="Frances Gulland and Jochen Wolf"
     gene            1..945
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 1 EST, and 100% coverage
                     of the annotated genomic feature by RNAseq alignments,
                     including 11 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:113915266"
     CDS             98..775
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X4"
                     /protein_id="XP_027436888.1"
                     /db_xref="GeneID:113915266"
                     /translation="

MASDSGDRGTACTLEFTVQMTCQSCVDAVRTSLQGVAGVQGVEVQLENQMVLVQTTLPSQEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILEGPGPVQGVVRFLQLSPERCLIEGTIDGLEPGLHGLHVHQFGDLTGNCNSCGDHFNPDGASHGGPQDSDRHRGDLGNVHADADGRASFRIEDEQLKNPKQICSCDGLTIWEERGRPIAGEGRKEPAKPPAHL"

     misc_feature    137..709
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      

tgtggcttccgaagctccgcctccccgcgacgcagttaggggtttgcgcctctgcgccggagcagtgcaggtccaacgggtggtggctgggtccgagatggcttcggactccggggaccgcgggaccgcctgcacgctggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacttccctgcaaggggtggcaggtgtccagggtgtggaagtgcagttggagaaccagatggtcctggtgcagactaccctgcccagccaagaggtgcaggcccttctggaaggcacagggcggcaggcggtgctcaagggcatgggcagtggccttttgcagaatctgggggcagcagttgccattctggagggtcctggtcctgtgcaaggggtggtgcgcttcctgcagctgagccctgaacgctgcctcatcgaggggaccattgatggcctggagcctgggctgcatggactccatgtccatcagtttggggacctcacagggaactgcaacagctgtggggaccactttaaccctgatggagcatctcacgggggccctcaggactctgaccggcaccgtggagacttggggaacgtccacgctgatgctgatggccgagccagcttcaggatagaggatgagcagctgaagaaccccaagcagatctgctcctgcgatggcctcaccatctgggaggagcgaggccggcctatcgctggtgagggacgaaaggagccggccaagccccctgcccacctctgagcatggcctcagcctcgggtttatgactgttcccccagctgagcaccgtccgcttccagagagaagggagggaggccctgcttgcctggccccaggagaactcgggtacagggggtgaagggtcgctgtaatgttcccttggcaaattaaagttttattttcatacagaa

//