GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 04:41:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_027317281             330 bp    mRNA    linear   PLN 08-DEC-2018
DEFINITION  PREDICTED: Coffea eugenioides protein CLAVATA 3 (LOC113772799),
            mRNA.
ACCESSION   XM_027317281
VERSION     XM_027317281.1
DBLINK      BioProject: PRJNA508372
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Coffea eugenioides
  ORGANISM  Coffea eugenioides
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae;
            Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade;
            Coffeeae; Coffea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_040035.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Coffea eugenioides Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..330
                     /organism="Coffea eugenioides"
                     /mol_type="mRNA"
                     /isolate="CCC68of"
                     /db_xref="taxon:49369"
                     /chromosome="1"
                     /sex="hermaphrodite"
                     /tissue_type="leaves"
                     /dev_stage="mature"
                     /country="Colombia: Cenicafe Estacion Central Naranjal,
                     Chinchina, Caldas"
                     /lat_lon="4.970533 N 75.649180 W"
                     /collection_date="Jul-2012"
                     /collected_by="Alvaro L. Gaitan, Ph. D."
     gene            1..330
                     /gene="LOC113772799"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:113772799"
     CDS             1..330
                     /gene="LOC113772799"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_027173082.1"
                     /db_xref="GeneID:113772799"
                     /translation="
MAFLSIVSKSAVMLFITALCFLFVMQLQASDCKMGSGCFYVKATLHEVHSRKLLEGMKGNEMVFKSGMAGSASGGKGMKVGAGWELREAPMGPDPLHHHGGGPKNAKTP"
ORIGIN      
atggccttcctttctattgtttccaagtctgctgtcatgctcttcatcactgccttgtgcttcctctttgtcatgcagctccaagcttctgattgcaagatgggcagtggatgcttctacgtcaaagcaactctgcatgaagtgcattccagaaagttgcttgaagggatgaagggcaatgaaatggttttcaagagtggcatggctggatcggcaagtggtggcaaagggatgaaggttggtgctggttgggagttgagggaggctccgatgggtccagaccccttgcaccaccacggtggcggccccaagaacgccaagacaccatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]