2024-05-17 04:41:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_027317281 330 bp mRNA linear PLN 08-DEC-2018 DEFINITION PREDICTED: Coffea eugenioides protein CLAVATA 3 (LOC113772799), mRNA. ACCESSION XM_027317281 VERSION XM_027317281.1 DBLINK BioProject: PRJNA508372 KEYWORDS RefSeq; includes ab initio. SOURCE Coffea eugenioides ORGANISM Coffea eugenioides Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_040035.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Coffea eugenioides Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..330 /organism="Coffea eugenioides" /mol_type="mRNA" /isolate="CCC68of" /db_xref="taxon:49369" /chromosome="1" /sex="hermaphrodite" /tissue_type="leaves" /dev_stage="mature" /country="Colombia: Cenicafe Estacion Central Naranjal, Chinchina, Caldas" /lat_lon="4.970533 N 75.649180 W" /collection_date="Jul-2012" /collected_by="Alvaro L. Gaitan, Ph. D." gene 1..330 /gene="LOC113772799" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:113772799" CDS 1..330 /gene="LOC113772799" /codon_start=1 /product="protein CLAVATA 3" /protein_id="XP_027173082.1" /db_xref="GeneID:113772799" /translation="
MAFLSIVSKSAVMLFITALCFLFVMQLQASDCKMGSGCFYVKATLHEVHSRKLLEGMKGNEMVFKSGMAGSASGGKGMKVGAGWELREAPMGPDPLHHHGGGPKNAKTP"
ORIGIN
atggccttcctttctattgtttccaagtctgctgtcatgctcttcatcactgccttgtgcttcctctttgtcatgcagctccaagcttctgattgcaagatgggcagtggatgcttctacgtcaaagcaactctgcatgaagtgcattccagaaagttgcttgaagggatgaagggcaatgaaatggttttcaagagtggcatggctggatcggcaagtggtggcaaagggatgaaggttggtgctggttgggagttgagggaggctccgatgggtccagaccccttgcaccaccacggtggcggccccaagaacgccaagacaccatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]