LOCUS       XM_027269449             552 bp    mRNA    linear   PLN 04-DEC-2018
DEFINITION  PREDICTED: Coffea arabica uncharacterized LOC113741807
            (LOC113741807), mRNA.
ACCESSION   XM_027269449
VERSION     XM_027269449.1
DBLINK      BioProject: PRJNA506972
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Coffea arabica (coffee)
  ORGANISM  Coffea arabica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae;
            Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade;
            Coffeeae; Coffea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_039898.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Coffea arabica Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 30% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Coffea arabica"
                     /mol_type="mRNA"
                     /cultivar="Caturra red"
                     /isolate="CCC135-36"
                     /db_xref="taxon:13443"
                     /chromosome="1c"
                     /sex="hermaphrodite"
                     /tissue_type="leaves"
                     /dev_stage="mature"
                     /country="Colombia: Cenicafe Estacion Central Naranjal,
                     Chinchina, Caldas"
                     /lat_lon="4.970533 N 75.649180 W"
                     /collection_date="Jul-2014"
                     /collected_by="Alvaro L. Gaitan, Ph. D."
     gene            1..552
                     /gene="LOC113741807"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 78% coverage of the annotated
                     genomic feature by RNAseq alignments, including 1 sample
                     with support for all annotated introns"
                     /db_xref="GeneID:113741807"
     CDS             169..552
                     /gene="LOC113741807"
                     /codon_start=1
                     /product="uncharacterized protein LOC113741807"
                     /protein_id="XP_027125250.1"
                     /db_xref="GeneID:113741807"
                     /translation="

MAFLSIVSKSAVMLFITALCCLFVMQLQASALADCKMGSGCFYVKATLHEVHSRKLLEGMKGHEMVFKSGGMAGSASGGKGMKVGAGWELREAPMGPDPLHHHGGGPRTPRHHSAFVDPHPFETELS"

ORIGIN      

ttgtgtaatctctctccaaaattggctgctcgtgcaatcatttgatagccttccaagacttctataaattggccatttttggcttcataagcttcacacactcaccattcctctactttctttctgagagattgcatttgcatgcactagtaaaagtaccataccaaaatggccttcctttctattgtttccaagtctgctgtcatgctcttcatcactgccttgtgctgcctctttgtcatgcagctccaagcttctgccttggcagattgcaagatgggcagtggatgcttctacgtcaaagcaactctgcatgaagtgcattccagaaagttgcttgaagggatgaagggccatgaaatggttttcaagagtgggggcatggctggatcggcaagtggtggcaaagggatgaaggttggtgctggttgggagttgagggaggctccgatgggtccagaccccttgcaccaccacggtggcggcccaagaacgccaagacaccatagtgcttttgtggatccccacccttttgagacagagttgtcttaa

//