GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 12:49:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_026983209            1100 bp    mRNA    linear   INV 06-NOV-2018
DEFINITION  PREDICTED: Drosophila erecta growth/differentiation factor 3
            (LOC6555854), transcript variant X2, mRNA.
ACCESSION   XM_026983209
VERSION     XM_026983209.1
DBLINK      BioProject: PRJNA501994
KEYWORDS    RefSeq.
SOURCE      Drosophila erecta
  ORGANISM  Drosophila erecta
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020825218.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila erecta Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1100
                     /organism="Drosophila erecta"
                     /mol_type="mRNA"
                     /strain="14021-0224.00,06,07"
                     /db_xref="taxon:7220"
                     /chromosome="Unknown"
                     /sex="pooled male and female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
     gene            1..1100
                     /gene="LOC6555854"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 5 Proteins, and 99%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 2 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:6555854"
     CDS             700..1002
                     /gene="LOC6555854"
                     /codon_start=1
                     /product="growth/differentiation factor 3 isoform X2"
                     /protein_id="XP_026839010.1"
                     /db_xref="GeneID:6555854"
                     /translation="
MIAPGERISGATTVTNYTNDPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHNRAPRPCCAPSKLEMLEILHVDEDHSDKLKISTWSDMQVVECACS"
     misc_feature    <760..996
                     /gene="LOC6555854"
                     /note="transforming growth factor beta (TGF-beta) like
                     domain found in TGF-beta superfamily; Region: TGF_beta_SF;
                     cl40434"
                     /db_xref="CDD:394804"
     misc_feature    order(775..789,880..894,901..903,967..975)
                     /gene="LOC6555854"
                     /note="homodimer interface 1 [polypeptide binding]; other
                     site"
                     /db_xref="CDD:381627"
     misc_feature    order(880..885,889..891,958..960,967..972)
                     /gene="LOC6555854"
                     /note="homodimer interface 2 [polypeptide binding]; other
                     site"
                     /db_xref="CDD:381627"
ORIGIN      
gacaaaccaaaaagcacaaacattataaagaggtactacatggcgaacaggatacaacgaatattctcttacactttccattgacaaatgcaaaagaggccaattttcataatgataaaattgacgaggccaatattagacttatgcttctctatagctcatccctggcaacaaattttcgacgtggacaaggatctagaaaaaaaaaggtcagtcacaatgatcaaatcgaaaggcactgtaattccggtgatgtcaacttgaaccaatccaaaaaaattcgtagtcagcagttaaatttgaaagtatatcaacttgtttcagcgaatagacgaagaaagatatcgtctcgaaaatttgaatttgaaaatgttggctacgaagaaacccgaacacagtggatagaattcgacgtgaccaaagctgttcgtagttggttgaacaaaagccatgaccacttgggaatagaaattcaatgttataagtgtaaaagtataggtgctcgtatactaagtgacttcagcccgtcgtcatcaccaaactcggcagcttcaaacaacgaacacctcaacatcatgccagttcttaatataattggacacggaacacttaattcccaagagcatggcgactcggacgttcaccacatcatactgaccaataacagaagcgatcaatacgtgcatcatcgttcagaccatgatagcacctggagaaaggataagtggagcaacaactgttacaaattacaccaacgatccgaaggtattcgatgcaggttactgccacggacgatgcccaccacgtcacaatcccgcccatcaccacgccctactgcaaagtctaatatggcaagaagatcacaaccgagccccccgtccatgctgcgctccttcaaagcttgagatgctagaaatattacatgttgacgaagatcacagcgacaaactaaaaatttcgacatggagtgatatgcaggttgtagagtgtgcctgttcgtaaaagaactctcccaatcgatttattcttacatacactctgtattttattattctttctaagtattgggttaacatgtaataaaaaagcataatatattt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]