2024-05-18 12:49:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026983209 1100 bp mRNA linear INV 06-NOV-2018 DEFINITION PREDICTED: Drosophila erecta growth/differentiation factor 3 (LOC6555854), transcript variant X2, mRNA. ACCESSION XM_026983209 VERSION XM_026983209.1 DBLINK BioProject: PRJNA501994 KEYWORDS RefSeq. SOURCE Drosophila erecta ORGANISM Drosophila erecta Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020825218.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila erecta Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1100 /organism="Drosophila erecta" /mol_type="mRNA" /strain="14021-0224.00,06,07" /db_xref="taxon:7220" /chromosome="Unknown" /sex="pooled male and female" /tissue_type="whole body" /dev_stage="adult" gene 1..1100 /gene="LOC6555854" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:6555854" CDS 700..1002 /gene="LOC6555854" /codon_start=1 /product="growth/differentiation factor 3 isoform X2" /protein_id="XP_026839010.1" /db_xref="GeneID:6555854" /translation="
MIAPGERISGATTVTNYTNDPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHNRAPRPCCAPSKLEMLEILHVDEDHSDKLKISTWSDMQVVECACS"
misc_feature <760..996 /gene="LOC6555854" /note="transforming growth factor beta (TGF-beta) like domain found in TGF-beta superfamily; Region: TGF_beta_SF; cl40434" /db_xref="CDD:394804" misc_feature order(775..789,880..894,901..903,967..975) /gene="LOC6555854" /note="homodimer interface 1 [polypeptide binding]; other site" /db_xref="CDD:381627" misc_feature order(880..885,889..891,958..960,967..972) /gene="LOC6555854" /note="homodimer interface 2 [polypeptide binding]; other site" /db_xref="CDD:381627" ORIGIN
gacaaaccaaaaagcacaaacattataaagaggtactacatggcgaacaggatacaacgaatattctcttacactttccattgacaaatgcaaaagaggccaattttcataatgataaaattgacgaggccaatattagacttatgcttctctatagctcatccctggcaacaaattttcgacgtggacaaggatctagaaaaaaaaaggtcagtcacaatgatcaaatcgaaaggcactgtaattccggtgatgtcaacttgaaccaatccaaaaaaattcgtagtcagcagttaaatttgaaagtatatcaacttgtttcagcgaatagacgaagaaagatatcgtctcgaaaatttgaatttgaaaatgttggctacgaagaaacccgaacacagtggatagaattcgacgtgaccaaagctgttcgtagttggttgaacaaaagccatgaccacttgggaatagaaattcaatgttataagtgtaaaagtataggtgctcgtatactaagtgacttcagcccgtcgtcatcaccaaactcggcagcttcaaacaacgaacacctcaacatcatgccagttcttaatataattggacacggaacacttaattcccaagagcatggcgactcggacgttcaccacatcatactgaccaataacagaagcgatcaatacgtgcatcatcgttcagaccatgatagcacctggagaaaggataagtggagcaacaactgttacaaattacaccaacgatccgaaggtattcgatgcaggttactgccacggacgatgcccaccacgtcacaatcccgcccatcaccacgccctactgcaaagtctaatatggcaagaagatcacaaccgagccccccgtccatgctgcgctccttcaaagcttgagatgctagaaatattacatgttgacgaagatcacagcgacaaactaaaaatttcgacatggagtgatatgcaggttgtagagtgtgcctgttcgtaaaagaactctcccaatcgatttattcttacatacactctgtattttattattctttctaagtattgggttaacatgtaataaaaaagcataatatattt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]