LOCUS       XM_026833044             252 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Diaphorina citri calcium-transporting ATPase type 2C
            member 1-like (LOC113473392), partial mRNA.
ACCESSION   XM_026833044
VERSION     XM_026833044.1
DBLINK      BioProject: PRJNA251515
KEYWORDS    RefSeq.
SOURCE      Diaphorina citri (Asian citrus psyllid)
  ORGANISM  Diaphorina citri
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Psylloidea; Psyllidae; Diaphorininae; Diaphorina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007405385.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Diaphorina citri Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..252
                     /organism="Diaphorina citri"
                     /mol_type="mRNA"
                     /db_xref="taxon:121845"
                     /chromosome="Unknown"
                     /collection_date="2010"
     gene            1..>252
                     /gene="LOC113473392"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 12 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:113473392"
     CDS             10..>252
                     /gene="LOC113473392"
                     /codon_start=1
                     /product="calcium-transporting ATPase type 2C member
                     1-like"
                     /protein_id="XP_026688845.1"
                     /db_xref="GeneID:113473392"
                     /translation="

MTEHQLQQVVNSVTVFYRVTPRHKLTIVKAFQANGVIVGMTGDGVNDGVALKKADIGIAMGKQGTDVCKEAADMILVDDDF"

     misc_feature    <10..>252
                     /gene="LOC113473392"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

atcgatcaaatgaccgaacatcagctgcaacaggtggtcaactccgtgactgtgttctatcgtgtgactccccgacataaactgactatcgtgaaggcattccaagcgaatggtgtaatagtgggtatgactggggatggcgttaatgacggtgtagcgctgaagaaggcagatattggaatagctatgggcaaacaaggaacggatgtgtgtaaggaagcggctgatatgattctggtggacgatgatttc

//