2024-05-19 09:39:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026483119 1092 bp mRNA linear MAM 12-JUN-2023 DEFINITION PREDICTED: Ursus arctos copper chaperone for superoxide dismutase (CCS), transcript variant X2, mRNA. ACCESSION XM_026483119 VERSION XM_026483119.4 DBLINK BioProject: PRJNA832286 KEYWORDS RefSeq. SOURCE Ursus arctos (brown bear) ORGANISM Ursus arctos Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ursus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026622908) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 12, 2023 this sequence version replaced XM_026483119.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_023065955.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1092 /organism="Ursus arctos" /mol_type="mRNA" /isolate="Adak" /db_xref="taxon:9644" /chromosome="Unknown" /sex="male" /tissue_type="blood" /dev_stage="adult" /ecotype="North America" gene 1..1092 /gene="CCS" /note="copper chaperone for superoxide dismutase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 long SRA reads" /db_xref="GeneID:113244058" CDS 325..999 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_026338904.1" /db_xref="GeneID:113244058" /translation="
MATDSGDRGTACTLEFTVQMTCQSCVDAVRTSLQGVAGVQSVEVQLENQMVLVQTTLPSEEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILEGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTGSCNSCGDHFNPDGASHGGPQDSDRHGMFQTFQSTETCPKLLCPHHPLSTVTNSWPVQLLASPVSSTPPAFLHRYFEADQDIISCN"
misc_feature 364..>804 /gene="CCS" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" ORIGIN
gacagcgggcccagcaaccggtggtaaaagcgctggagctcgggttccggtttatagggctccatctttgcgctgccggcgcgggaggtctgggaaaagcggccaagaggttactaaggcaaccaggggccggagggtccgagtgcgcctgcgcagccagtgccttccaacgcgtggcgtcgggagggcgggcctgacgtgcgcgcgcaccaggaggcggggcaaagtgtggcttccgaagctccgcctccccgcgacgcagttaggggtttgtgcttcaacgctggagcggttcgggtccgaaggctggtgactgggtccgggatggctacggactccggggaccgcgggaccgcctgcacgctggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggagtggcaggtgtccagagtgtggaagtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagcgaagaggtgcaggcccttctggaaggcacagggcgacaggcggtgctcaagggcatgggcagtggcctattgcagaatctgggggcagcagttgccattctggagggccctggtcctgtgcaaggggtggtgcgcttcctgcagctgacccctgaacgctgcctcatcgaggggaccattgatggcctggagcctgggcctcatggactccacgtccatcagtttggggacctcacagggagctgcaacagctgtggggaccactttaaccctgatggagcatctcacgggggccctcaggactccgaccggcatggaatgtttcagacattccaaagtacagaaacttgtcccaagctcctgtgtccccatcacccactttcaaccgtgaccaactcttggccagtccaactcttggccagtcctgtttcatctacacctccagcctttctccaccgatattttgaagcagatcaagacatcatttcatgtaactaagcaccgtggggacctggggaacgtccatgctgatgctgatggccgagccagctttaggatagaggatgagcagctgaaggtatggtggaaaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]