GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 09:06:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_026458019            1166 bp    mRNA    linear   INV 28-SEP-2018
DEFINITION  PREDICTED: Hyposmocoma kahamanoa lipopolysaccharide-induced tumor
            necrosis factor-alpha factor homolog (LOC113225650), mRNA.
ACCESSION   XM_026458019
VERSION     XM_026458019.1
DBLINK      BioProject: PRJNA493257
KEYWORDS    RefSeq.
SOURCE      Hyposmocoma kahamanoa
  ORGANISM  Hyposmocoma kahamanoa
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata;
            Ditrysia; Gelechioidea; Cosmopterigidae; Cosmopteriginae;
            Hyposmocoma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020653611.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Hyposmocoma kahamanoa Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1166
                     /organism="Hyposmocoma kahamanoa"
                     /mol_type="mRNA"
                     /isolate="Upper Pololo Valley"
                     /isolation_source="Oahu"
                     /db_xref="taxon:1477025"
                     /chromosome="Unknown"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /country="USA: HI, Oahu"
                     /collection_date="2017"
                     /collected_by="Daniel Rubinoff"
                     /identified_by="Daniel Rubinoff"
     gene            1..1166
                     /gene="LOC113225650"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:113225650"
     CDS             87..467
                     /gene="LOC113225650"
                     /codon_start=1
                     /product="lipopolysaccharide-induced tumor necrosis
                     factor-alpha factor homolog"
                     /protein_id="XP_026313804.1"
                     /db_xref="GeneID:113225650"
                     /translation="
MEEKSGNPLPYSGVPTYPHQQLPPDPVNVVPGGVIVQNPIQPNVVSAIVVSPPVGPKPSHMTCQSCGAEIVTRVEYKPSTKTHLIALALCSLGCWCCVCIPYCKDSCQNADHYCPNCDSYIGVYSS"
     misc_feature    252..458
                     /gene="LOC113225650"
                     /note="LITAF-like zinc ribbon domain; Region:
                     zf-LITAF-like; pfam10601"
                     /db_xref="CDD:431386"
ORIGIN      
accacccatgcgtggtgaccgatagctacgttttaaaaaattaattaaaagagtttcattaagtgttggaaataagtttcatcgaaatggaagaaaaatctgggaatccactgccatactctggagtgccaacgtaccctcaccagcagcttccaccagacccagttaatgtggtccctggtggagtcatcgtccagaaccctatacaaccaaacgtagtttcagccatagtggtcagcccaccggttgggccgaaaccttcccatatgacctgtcagtcttgcggagcagaaattgtaaccagagttgaatataaaccttcaacaaaaactcacctgattgcattagctctttgtagtttgggttgctggtgctgcgtttgcatcccgtattgcaaagattcctgccagaacgccgaccattactgccctaattgtgactcgtatattggagtgtactcttcctagattgtcataatttcgagaagtattttgcactctacctatctatggctttttgggatcaaattttgttagtgtaagcgtcagcgcaaagcggtggctggcaattcagaggacattaaattcttcaatgcatattctatgcaatttcaattaattgaaataatgacctgagaccggcttcagagcatcgtggcgcatttgtctttgcggtattgaagagcacgctagacgatatcgatatgcaacggaatccaccggttttgcacctagatgcgctgcgcttcactgcgtagttgctagtgaaacaaattgtaatccatttgtaatccaagcgaccgatgggatgtcggcggatgccgcagaatcgtaaaggatcctcatttcattccggtttgcgttggcctttaaagatatgtcatttatggtccctaaattagaacgcttgtattgctattaaagtcaatatcgaacccttaaaaaccattcgatgttttggaatatgacatatagctgctagaaaaagtttgtcaccgttgtgtatttttgttgagtacatatttctagtacatttatgacgagaataattcgcgaaagaaaatatgcgaggatcgtaagtggtgatcaaagtgtgggtataactacacgtacaagggactagtcaactgtatgtcttagagcgacaggtgcagtgacagtgcacct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]