LOCUS       XM_026160838            1053 bp    mRNA    linear   VRT 04-SEP-2018
DEFINITION  PREDICTED: Astatotilapia calliptera copper-transporting ATPase
            2-like (LOC113017725), transcript variant X5, mRNA.
ACCESSION   XM_026160838
VERSION     XM_026160838.1
DBLINK      BioProject: PRJNA488811
KEYWORDS    RefSeq.
SOURCE      Astatotilapia calliptera (eastern happy)
  ORGANISM  Astatotilapia calliptera
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Cichlomorphae; Cichliformes;
            Cichlidae; African cichlids; Pseudocrenilabrinae; Haplochromini;
            Astatotilapia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020535728.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Astatotilapia calliptera Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1053
                     /organism="Astatotilapia calliptera"
                     /mol_type="mRNA"
                     /db_xref="taxon:8154"
                     /chromosome="Unknown"
     gene            1..1053
                     /gene="LOC113017725"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:113017725"
     CDS             55..999
                     /gene="LOC113017725"
                     /codon_start=1
                     /product="copper-transporting ATPase 2-like isoform X2"
                     /protein_id="XP_026016623.1"
                     /db_xref="GeneID:113017725"
                     /translation="

MMQENDHDIEKQGFENLAYEYGSQTELCPPPKAASRASFKLQRITSEHEVHIIQTRICSLNGIIAVTWSVPNSLAKVDYDASVIPTKEIALELQTLGYSVESVVQIRVDEPIKSVQSHEKSQPVSFGLSDMSTNRPVVSNGTGSQAPSASSPEIKAQKCFICVTGMTCASCVSNIERNLLKHRGIFSVLVSLMAGKAEVKYDSHVLDATAVTELIKDLGFGAKVIEDNAVAHGKLDLTITGMTCASCVHNIESKLNLTRGILMASVALATNKAQVEFDPEVLGPRDIIKLIQGLGFEARLATWQRPQQTMWKST"

     misc_feature    541..723
                     /gene="LOC113017725"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(550..558,565..567)
                     /gene="LOC113017725"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    760..951
                     /gene="LOC113017725"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(778..786,793..795)
                     /gene="LOC113017725"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
ORIGIN      

cacctgaaagaacatatttacataacatgcagttacggcgtgacgcaggtgctcatgatgcaggagaatgaccatgacattgagaaacaaggctttgaaaacctggcctacgagtatgggagccaaactgagctctgccctccacctaaagctgcctcaagagcatcttttaaacttcagcggatcacctctgagcatgaggtccacatcatccaaaccagaatctgcagcctgaatggaataattgctgtcacatggtctgtacccaacagtttggccaaggtggactatgatgcttcagttattccaaccaaagagatcgccctggaactacagaccttgggatacagcgtggagtctgtggtgcagatcagggtggatgaacctataaagagtgttcagagtcatgaaaagtcccagcctgtaagctttggactttctgacatgtcaacaaacaggcctgtagtcagcaatgggacgggttcacaggcaccatctgcaagttcgcctgagataaaagcacagaaatgcttcatctgcgttacggggatgacctgtgcctcctgtgtgtccaacatcgagaggaacctgctcaaacacagaggaatcttctcagtgttggtgtcgctaatggccggtaaggcagaggtgaagtatgattcacatgtcctggatgctactgcagtgactgagctcatcaaagacttgggctttggtgccaaagtgattgaggataatgcagtagcacatggaaagctggacctcactataacaggcatgacgtgcgcatcatgtgtccacaacatcgagtccaagctcaacttaaccagagggatcctcatggcttcggtcgcactggcaaccaacaaagctcaggttgagtttgacccagaggtgctcggacctcgggatattatcaagctcatccagggtcttggatttgaggccaggctggctacatggcagcgtccccagcaaaccatgtggaagtcaacctgaccgcgtagctactcatgcagcaagaggcaacagatggatgagggaaggggaggc

//