2024-04-29 09:00:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026071806 1320 bp mRNA linear VRT 08-AUG-2018 DEFINITION PREDICTED: Apteryx rowi homeobox B8 (HOXB8), transcript variant X1, mRNA. ACCESSION XM_026071806 VERSION XM_026071806.1 DBLINK BioProject: PRJNA484763 KEYWORDS RefSeq. SOURCE Apteryx rowi (Okarito brown kiwi) ORGANISM Apteryx rowi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Palaeognathae; Apterygiformes; Apterygidae; Apteryx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020449764.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Apteryx rowi Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1320 /organism="Apteryx rowi" /mol_type="mRNA" /isolate="R43461" /specimen_voucher="ROM:ORN:R43461" /db_xref="taxon:308060" /chromosome="Unknown" /sex="male" /tissue_type="blood" /dev_stage="adult" /country="New Zealand: Okarito, Westland" /collection_date="16-Jul-1993" /collected_by="Royal Ontario Museum" gene 1..1320 /gene="HOXB8" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 25 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:112968987" CDS 1..729 /gene="HOXB8" /codon_start=1 /product="homeobox protein Hox-B8 isoform X1" /protein_id="XP_025927591.1" /db_xref="GeneID:112968987" /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQELGGRPTVVYGPSAGGTFQHPPQIQEFYHGASSLSSSPYQQNPCAVACHGDPGNFYGYEPLQRQSLFAAQDSELVQYTDCKLAAGGLGEEAESAEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
misc_feature order(436..450,454..456,505..507,523..525,562..564, 568..573,580..585,589..597,601..606) /gene="HOXB8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(442..444,451..453,571..573,580..585,592..594) /gene="HOXB8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 445..603 /gene="HOXB8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" ORIGIN
atgagctcttacttcgtcaactcactcttctccaaatacaaaaccggggactccttgcgtcccaactactatgactgcgggttcgcccaggagctcgggggcagacccacggtggtgtacggacccagcgcggggggcaccttccagcaccccccccagatccaggagttttaccacggcgcctcctcgctctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggcgaccccggcaacttctacggctacgagcccttgcaaaggcagagcctcttcgccgcccaggactcggagctggtgcagtacacggactgcaagctggcggccggcggcctcggcgaggaggcggagagcgcggagcagagcccttcgcccacccagctcttcccctggatgcgaccgcaagcagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggaagagcccctgagtcccacattaatggcagttaatgtaagggaggggtgggaaaaaaacaacaatgcatagaaaagagaaagaaaaaaaaamccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatctggaggtctctccagccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaatcttctctctctctctgtccttctctctgtctctctcttctttcctggggggtgggttggttaacatagctttcaatgctataggagttatgtgaaattacatttgtgcacttttttaatttcccaccttttttgttgtggtttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgctgtagttatctctctctttctctccctccctctctctttttactttccttacttctgttcttttgtttggttcgggatttttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]