2024-05-16 19:35:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_025935416 397 bp mRNA linear PLN 27-JUL-2018 DEFINITION PREDICTED: Panicum hallii protein FLORAL ORGAN NUMBER2-like (LOC112872312), mRNA. ACCESSION XM_025935416 VERSION XM_025935416.1 DBLINK BioProject: PRJNA482138 KEYWORDS RefSeq; includes ab initio. SOURCE Panicum hallii ORGANISM Panicum hallii Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum; Panicum sect. Panicum. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_038049.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Panicum hallii Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 31% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..397 /organism="Panicum hallii" /mol_type="mRNA" /strain="FIL2" /db_xref="taxon:206008" /chromosome="8" gene 1..397 /gene="LOC112872312" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 59% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:112872312" CDS 89..397 /gene="LOC112872312" /codon_start=1 /product="protein FLORAL ORGAN NUMBER2-like" /protein_id="XP_025791201.1" /db_xref="GeneID:112872312" /translation="
MARFFLCLAAAACCLVLLVPPVHGRLGIGRAGGLGAANRHTAAEEQQRGTAVKAASSAWSTSWTAAAASGRVRPELRSVPGGPDPLHHHGSPWRPELEPTTP"
ORIGIN
gaggatagcagcttgtgtgcgccctctggtttttacaccgcgggttcttcttccagctccaggttgtgtcgcctttggccaacaagccatggcccggttcttcctgtgcttggcggcggcagcgtgctgccttgtgttgctggttcctccggttcatgggcgccttggcattggtcgggccggtgggcttggtgcggcgaaccggcacacggcggcggaggagcagcagcgcggcacggcggtgaaggccgcgtcgtcggcgtggtcaacgtcgtggacagcggcggcggcgtctgggagggtgaggccggagctgcggtccgtgccggggggcccggacccgctgcaccaccacggcagcccgtggcggccggagctggagccgaccaccccgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]