LOCUS       XM_024898053             150 bp    mRNA    linear   PLN 27-APR-2018
DEFINITION  Trichoderma citrinoviride hypothetical protein (BBK36DRAFT_38962),
            partial mRNA.
ACCESSION   XM_024898053
VERSION     XM_024898053.1
DBLINK      BioProject: PRJNA453598
            BioSample: SAMN05369575
KEYWORDS    RefSeq.
SOURCE      Trichoderma citrinoviride (Hypocrea schweinitzii)
  ORGANISM  Trichoderma citrinoviride
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae;
            Trichoderma.
REFERENCE   1  (bases 1 to 150)
  AUTHORS   Atanasova,L., Chenthamara,K., Zhang,J., Grujic,M., Henrissat,B.,
            Kuo,A., Aerts,A., Salamov,A., Lipzen,A., Labutti,K., Barry,K.,
            Miao,Y., Rahimi,M.J., Shen,Q., Grigoriev,I.V., Kubicek,C.P. and
            Druzhinina,I.S.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Multiple horizontal gene transfer events from other fungi enriched
            the ability of initially mycotrophic Trichoderma (Ascomycota) to
            feed on dead plant biomass
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 150)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 150)
  AUTHORS   Kuo,A., Atanasova,L., Chenthamara,K., Zhang,J., Grujic,M.,
            Henrissat,B., Aerts,A., Salamov,A., Lipzen,A., Labutti,K.,
            Barry,K., Miao,Y., Rahimi,M.J., Shen,Q., Grigoriev,I.V.,
            Kubicek,C.P., Druzhinina,I.S., Nordberg,H.P., Cantor,M.N. and
            Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020194720).
            
            ##Metadata-START##
            Organism Display Name :: Trichoderma citrinoviride TUCIM 6016 v4.0
            GOLD Stamp ID         :: Gp0009711
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..150
                     /organism="Trichoderma citrinoviride"
                     /mol_type="mRNA"
                     /strain="TUCIM 6016"
                     /db_xref="taxon:58853"
                     /chromosome="Unknown"
     gene            <1..>150
                     /locus_tag="BBK36DRAFT_38962"
                     /db_xref="GeneID:36606171"
     CDS             <1..>150
                     /locus_tag="BBK36DRAFT_38962"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024747077.1"
                     /db_xref="GeneID:36606171"
                     /db_xref="JGIDB:Trici4_38962"
                     /translation="

AATAVSFFRTDYVLTSIESCGTMGNCTTTCSDKTGTLTQNSMTVILGALG"

     misc_feature    <52..>150
                     /locus_tag="BBK36DRAFT_38962"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

gcagccacagccgtctcttttttccgcacggactacgtacttacaagcatcgaatcatgcgggacaatggggaactgcacaactacctgttcggacaaaacaggcaccctgactcaaaactcgatgactgtgattttaggcgcactagga

//